KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0637300-01Help
Entry
Os07t0637300-01   CDS       T02163                                 

Gene name
Os07g0637300
Definition
Similar to Pyruvate dehydrogenase kinase.
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Os07t0637300-01 (Os07g0637300)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   Os07t0637300-01 (Os07g0637300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(26484935..26485165,26483865..26484126,26483476..26483656,26483092..26483239,26482154..26482358,26481836..26481894))
AA seq 361 aa AA seqDB search
SEPVARAVAEEVGRWGSMKQTGVSLRYMMEFGSRPTERNLLLSAQFLQKELPIRIARRAL
ELESLPFGLSRKPAILKVRDWYLDSFRDIRYFPEVRNRNDELAFTQMIKMIKVRHNNVVP
TMALGVQQLKNEQYRTRKIPTAFDEIHEFLDRFYMSRIGIRMLIGQHVALHDPDPEPGVI
GLINTELSPIQVAQAASEDARSICLREYGSAPEIDIYGDPTFTFPYVSSHLHLMLFELVK
NSLRAVQERYMNSDKDVPPVRIIVADGAEDVTIKVSDEGGGIPRSGLPRIFTYLYSTAKN
PPDMDCPSEGVTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEEPL
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
tcggagccggtggcgagggcggtggcggaggaggtggggaggtgggggagcatgaagcag
acgggggtgagcctgcgctacatgatggagttcgggtcgcgccccacggagcggaacctg
ctgctctccgcgcagttcctgcagaaggagctcccaatccggatcgcgcgccgcgcgctc
gagctcgagtccctccccttcggcctctcccgcaagcccgccatcctcaaggtgcgggat
tggtacttggactctttccgcgacatcagatactttccagaagtgaggaataggaacgac
gagctcgcttttacgcagatgatcaagatgatcaaagtacgccacaataatgtggttcca
acgatggcactgggagttcaacagctcaagaacgagcagtatcgcacaaggaagatcccc
actgcatttgacgagatccacgagtttcttgacagattctacatgtcaaggattgggatc
cgcatgcttatagggcagcatgtggctttgcatgatcctgacccagagcctggcgtcata
ggcctcattaatacagaattgtcccctatacaggtggctcaagctgccagtgaagatgcc
cgttctatttgtttgagggaatatggatcagctcctgagattgacatctatggagaccca
acttttacatttccatatgtttcatcacatctacatctcatgctatttgaattggtgaag
aactccttgcgtgcagtacaggaacgatatatgaattccgataaagatgttcctccagtt
agaattatcgttgctgatggggcagaggatgtaactatcaaggttagtgatgaaggtggt
ggaataccaaggagcggccttccaagaattttcacatatctatatagcactgcaaagaat
ccacctgatatggattgccctagtgaaggagtaactatggctggatatggctatggtctt
ccaatcagtcgcctgtatgctcgatattttggtggtgacctgcaaatcatctctatggaa
ggatacggcaccgatgcttacctgcacttgtcacggttgggagattcggaggagcccttg
ccttga

DBGET integrated database retrieval system