KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0661300-01Help
Entry
Os07t0661300-01   CDS       T02163                                 

Gene name
Os07g0661300
Definition
Similar to Ubiquitin-specific protease 24.
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os07t0661300-01 (Os07g0661300)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os07t0661300-01 (Os07g0661300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr07:join(27884568..27885089,27885173..27885360,27885943..27886184,27886757..27886899,27887228..27887404,27887683..27887880)
AA seq 489 aa AA seqDB search
LSDGQNKIIITKDIACSNKKETVAPTLPNGKPVLFNGSPTANANVSPNNGVIENNQKAVA
AVLTSVPAKNVSSPAPLSVPEVDHDGIERNQNSSLVPEITENGGPAIDTPTTAAPVDELV
TSLNKKDFRNKPLLPHGLKNTGNICFLNSSLQALLSCWPFVQLLQNLRNQNIPKAGYPTL
NAFIEFISQFDVLDDSNVKKDEKFATIASKSVIPSMFDTVLRNFTPDVPAGTASRPRQED
AQEFLSFAMDRMHDELVKLNGNGSNSKEGMIVSSNDDDAWETVGKKNKSAIMRSQSFVPS
ELTAIFGGQLQSCVKATGNKASVTVQPFRLIHLDIFPDAVQKLDDALRLFAAPESLEGYR
TAAGKAGLVTARKSVKIHSLSKIMILHLKRFSYGSHGCTKLFKPIHFPLELVLSRDLLSS
PSSEHMQSRRYELVATITHLGANPSRGHYTADAKSASGQWLRFDDDNVTPVSLNKVLHDQ
AYVLFYKQL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttaagtgacggccagaacaaaatcatcattacaaaggatattgcatgcagcaacaaaaag
gaaacagtagctcctacattaccaaatggcaagccagtgctattcaatggatctcccact
gccaatgccaatgtgtctcccaacaatggcgtcattgagaataatcagaaggctgtagct
gcagttctcacgagtgttcctgctaaaaatgtcagcagcccagcaccactttcagttcca
gaggtggaccatgatgggatcgaacgcaatcaaaacagcagtttagtcccagaaataact
gaaaatggagggccagctattgatacaccaactactgcagctccagtggatgagcttgtg
acaagcttaaataaaaaggactttcggaacaagcccttgcttcctcatggtttgaagaat
acaggaaatatatgcttcctgaattcatccttgcaggcattgctctcatgctggcctttt
gtccagcttttacagaacttgaggaaccagaatatacctaaggctggttacccaacactg
aatgcatttattgagttcatctctcaattcgacgtgctcgatgattcaaatgttaagaaa
gacgagaagtttgctacaatagcttcaaaatcagttattccctccatgtttgacacagtt
ctgagaaattttactccagatgtgccagctggaacagcttctaggccaaggcaggaagat
gctcaagaattcttaagttttgcgatggatagaatgcatgatgaactagtgaagcttaat
ggcaatggctcaaattcaaaggagggtatgattgtttcatcaaatgatgatgatgcttgg
gagactgttggaaagaagaacaagtcagccataatgaggagtcagagttttgttccctcc
gagttaactgctatttttggaggccagctgcaaagctgtgtgaaagctactggtaacaaa
gcatcagtcaccgttcagccttttcgactgatccatcttgacatattccccgatgctgtt
cagaaacttgatgatgcccttcgtctgtttgctgctcctgaatctttggaaggatacaga
acagctgctggaaaggctgggttggtgacggctagaaaatcagtgaagatacactcactt
tcaaagataatgatactgcacctgaagaggtttagttatggaagtcatggctgcacgaaa
ctcttcaagccaattcacttccctcttgagctggttcttagtcgtgatctgctgagttcg
ccatcatcagagcacatgcagagtagaagatatgagcttgttgcaaccatcacgcatctt
ggggcaaacccgtccaggggccattacactgccgatgcaaagtctgccagtgggcagtgg
cttcgcttcgacgatgataacgtcacacctgtcagtctgaacaaggtcttgcatgaccaa
gcatatgtcctgttctacaaacaattataa

DBGET integrated database retrieval system