KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0662900-01Help
Entry
Os07t0662900-01   CDS       T02163                                 

Gene name
Os07g0662900
Definition
Similar to 4-alpha-glucanotransferase (EC 2.4.1.25).
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os07t0662900-01 (Os07g0662900)
Enzymes [BR:dosa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Os07t0662900-01 (Os07g0662900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:join(27961274..27961618,27961781..27961898,27962232..27962284,27962387..27962514,27962633..27962762,27963026..27963222,27963308..27963386,27963533..27963571,27963781..27963900,27963996..27964097,27964233..27964316,27964411..27964653,27964735..27964860,27964944..27965018,27965113..27965184,27965386..27965505,27965654..27965751,27966222..27966381,27966461..27966559,27966701..27966898,27966983..27967076,27967611..27967771)
AA seq 946 aa AA seqDB search
MTNLSGKKSLNTVTLVFKLPYYTQWGQSLLIAGSEPALGSWNVKQGLSLSPVHQGNELIW
SGRVSVATGFTCQYNYYVVDDNKNVLRSESGEKRKLVLPEGVQDGDVVEIRDWWQDASEA
LFLRSAFKNVIFNGSENAKRELKTTSLNKSLEPEDIVVQFIVSCPRLGAGSTVVVTGSNP
QLGRWQTQDGLKLNYVGDSIWKANCLLRKSEFPIKYKYCKISEAGVSSLEFGPNREADVD
LSSPKPSRYVLLSDGALRESPWRGAGVAVPIFSIRSNEDLGVGEFLDLKLLVDWAVNSGF
HLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSDAIPGDIKDEISQAKKQL
DKKDVDYEASLASKLSIARKIFKLEKDKVLNSSSFKQFLSENEEWLKPYAAFCFLRDFFE
TSDHSQWGRFSQFSKEKLDKLVSEGTLHHDVICFHYYIQYHLYMQLSEAAAYARKKKVIL
KGDLPIGVDRNSVDTWVYPTLFRMNTATGAPPDYFDKNGQNWGFPTYNWEEMSKDNYGWW
RARLTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIALSQEELLSEGLWDFD
RMSRPYILQETLEEKFGSFWTVIAANFLNEYKKQHYEFKEDCNTEKKIIAKLKNSSEKSL
WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKFYPRFNQEDTSSFNDLDEHSKNILRRLYYD
YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS
EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDGGRRSRFYQTVIGSDDEPPSRCTPE
VANFIVKQHFDAPSMWAIFPLQDLLALKDKYTTRPAKEETINDPTNPKHYWRFRLHVTLD
SLLDDKDIQATIKELVTSSGRSFPGKVDGAEESGEKLAKVQLNGKP
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttgtccgggaagaaatctctgaatacagtgaccttggtcttcaaattaccc
tactacacacaatgggggcagagtcttctcatcgccggctcagagccagcacttggatct
tggaatgttaagcaaggattgtctctcagtccagttcatcagggaaatgagctaatctgg
tccggcagagtttccgtcgctactggttttacctgccagtacaattactatgtagtggac
gacaacaagaatgttttgagatcggagtccggggagaaaaggaaattagtacttccagag
ggtgttcaggatggagatgtagttgagatacgcgactggtggcaggatgcttctgaagct
cttttccttcgaagtgcattcaagaatgtcattttcaatgggtctgaaaatgctaaaaga
gaattgaagactacatccctcaacaaaagtttggagcctgaagatattgttgttcagttt
attgttagctgtccccgacttggagctggctctactgtcgtggtcacaggaagtaatcct
caattaggaaggtggcaaacacaagatggcctcaagcttaattatgtcggagattccatc
tggaaagcaaactgtctgttgcgaaagtctgagttcccaataaaatataaatactgtaaa
attagtgaagcaggagtctcttcattggagttcggtccgaacagggaggctgatgtggat
ctatcatcacccaagccatccagatacgtcctcttgtctgatggtgcccttcgggaatca
ccatggaggggtgcaggtgttgctgtacctatattctcgatcaggtcaaatgaggacctt
ggtgttggagaattccttgatcttaaacttcttgttgactgggcagtcaactcaggcttt
catcttgttcagcttcttcctatcaatgatacttcagttcacgggatgtggtgggattca
tacccatacagctcgctctctgtgtttgcattgcaccccttgtacctgagagtacaagca
ctttcagatgcaattccaggggatattaaggacgagatttcacaggcaaagaagcagttg
gacaaaaaggatgttgactatgaggcatcactggcctcaaaactctcgatagcaagaaaa
atattcaaattagagaaagacaaagtactaaattccagttcgttcaagcagtttttatct
gaaaacgaggagtggttgaaaccatatgctgcattttgttttctgcgggacttctttgag
acatcagatcacagccaatggggccgtttttctcagttttccaaggagaagctagataag
cttgtttctgaaggtaccttgcaccatgacgttatatgtttccattactacatccagtac
catctatatatgcaattatcagaggcagctgcctatgcaaggaagaaaaaggttattctg
aaaggagatttacctattggtgttgataggaatagtgtggatacttgggtataccccact
ttatttcgcatgaatacagctactggtgcacctccagattatttcgacaaaaatggacaa
aattggggttttcctacatataactgggaggaaatgtcaaaggataattatgggtggtgg
cgagctcgtctgacacagatggcaaaatacttcactgcatataggatagaccatatcttg
ggtttctttaggatatgggagcttccagatcatgcagccacaggtctagttgggaaattt
aggccttcaattgctctcagtcaggaggagcttcttagtgaaggcctatgggatttcgat
agaatgagccgcccttatattcttcaggaaacactggaggagaagtttgggtccttttgg
acagtaattgcagctaactttctaaatgagtacaagaaacaacattacgagttcaaagag
gactgcaatacagagaaaaagataattgcaaagcttaagaacagttctgaaaaatcatta
tggctggagaaagaagacagcattcggcgtggtttgtttgatctactacagaatatagtc
cttattagagatccagaggacagcacaaaattttatccccgcttcaaccaggaggatact
tcaagttttaacgatctagatgaacatagcaaaaatatcctcagaagattgtactatgac
tattattttgctcgccaagagaatctctggcgtcaaaatgcgctcaagactctgcctgtg
cttttgaactcatcggatatgttggcatgtggggaagatcttggccttatccctgcctgt
gttcaccctgttatgcaagaacttggattgattggattgcgtatccagagaatgcccagt
gaaccaaacttggaatttggtattccatctcagtatagctacatgacggtttgtgctccg
tcatgtcatgattgctccacattacgtgcttggtgggaagaagatggaggaagaagaagc
cgtttctaccagactgtaattggtagtgatgacgagccgccatctcgctgcaccccagaa
gtagcgaactttattgttaagcagcattttgatgctccatcaatgtgggcaatcttccca
ctacaggacctgcttgcacttaaagacaagtacaccacaagaccagcaaaagaggaaaca
atcaatgacccaactaacccgaagcattattggagattccggctacatgtgacattggat
tcgctgttggacgataaggacatccaagcaaccatcaaggaacttgtcacaagtagtggg
aggtcatttcctggtaaggtggatggcgccgaagaaagcggagagaagctagctaaagtc
cagttgaatggtaaaccatag

DBGET integrated database retrieval system