KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0669100-01Help
Entry
Os07t0669100-01   CDS       T02163                                 

Gene name
Os07g0669100
Definition
Similar to Xylose isomerase (EC 5.3.1.5).
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os07t0669100-01 (Os07g0669100)
   00051 Fructose and mannose metabolism
    Os07t0669100-01 (Os07g0669100)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Os07t0669100-01 (Os07g0669100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(28276215..28276274,28276011..28276121,28275734..28275808,28275506..28275635,28275320..28275411,28274849..28274899,28274679..28274758,28274545..28274599,28274365..28274466,28274209..28274260,28274084..28274129,28273954..28274009,28273721..28273772,28273565..28273644,28273380..28273450,28273246..28273286,28273046..28273145,28272896..28272967,28272728..28272805,28272584..28272619))
AA seq 479 aa AA seqDB search
MMGAKLLLLLVASSLCLSAAIATQQTCPADLDSKCGDAASGDWEGEFFPGIPKIKYEGPS
SKNPLAYKWYNAEEVILGKKMKDWMRFSVAFWHTFRGTGGDPFGAPTKSWPWEDGTNSLD
MAKRRMRAHFEFMEKLGVDRWCFHDRDIAPDGKTLTETNKNLDEIVELAKKLQEETNIKP
LWGTAQLFMHPRYMHGAATSPEVKVYAYGAAQVKKALEVTHYLGGENYVFWGGREGYQTL
LNTDMKRELDHLASFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKY
GLTGEFKINVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDISE
ATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVVKLIEDG
SLDELVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEILFQAAL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatgggggcaaagcttttgctcttactggtggcctcatctctatgtctatctgctgcg
atcgctacgcagcaaacctgtccggccgacctcgatagcaagtgtggtgatgctgcttca
ggggattgggaaggggagttcttccctggcatccccaagatcaagtatgagggtccaagc
agcaagaacccgcttgcttacaagtggtacaatgctgaggaagtgattcttgggaagaag
atgaaggattggatgcggttcagcgtggccttttggcatacgttccgtggtactggagga
gatccttttggtgcccctacaaagtcttggccttgggaggatggcacaaattcgttggac
atggctaagagaagaatgagagctcactttgagttcatggagaagcttggagttgacagg
tggtgcttccatgacagggatattgcccctgatggcaaaacactcacggaaacaaataaa
aatttggatgagatagttgaactggcaaagaaactccaggaggagaccaatataaaacca
ctgtgggggactgcacagcttttcatgcacccgcgctacatgcacggtgctgctactagc
ccagaggttaaagtgtatgcttatggtgctgctcaagttaagaaagctttagaggtcacc
cactacctaggcggtgaaaactatgttttctggggaggaagagagggttaccaaactctt
cttaatactgacatgaagagagaacttgaccatttggctagttttcttcaagctgcagtt
gactacaagaagaagattggatttaatggaacactcttgatagagcctaaaccacaagaa
cccacaaaacaccagtacgattgggatgttgcaaccacattctctttcctacagaaatat
ggtctaacaggagaattcaagataaatgttgaatgcaaccacgctactctatctggacat
agctgccaccatgagcttgagactgcaagaattaatggtctgcttgggaatattgatgcc
aacactggtgatccccagatcggttgggacaccgatcagttccttacagatatttcagag
gctactttggttatgtcaagtgtggttaagaatggtgggcttgcacctggtggattcaac
tttgatgccaaattgaggagggagagtactgatgttgaggacatgtttctggctcatata
tcgggaatggacaccctagcccgcggccttcggaatgttgtcaagctgatcgaggatggt
tccctggatgagcttgttcgcaagcgctaccagagttttgatagtgagatcggtgccttg
attgaggctgggaaaggagacttcgagacactagagaagaaggttctggagtggggtgaa
cccattgttccatctggcaagcaggaactggctgagattctgttccaagctgctctatag

DBGET integrated database retrieval system