KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0679300-01Help
Entry
Os07t0679300-01   CDS       T02163                                 

Gene name
Os07g0679300
Definition
Similar to Alpha-galactosidase precursor (EC 3.2.1.22) (Melibiase) (Alpha-D- galactoside galactohydrolase).
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dosa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dosa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dosa00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dosa00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:join(28764514..28764707,28764861..28764919,28765289..28765345,28765436..28765470,28765701..28765804,28765903..28765975,28766073..28766131,28766234..28766299,28766393..28766476,28766573..28766637,28766730..28766810,28767098..28767190,28767654..28767712,28768310..28768450,28768792..28768899)
AA seq 425 aa AA seqDB search
MEAPRLRLPFLLLVALVVSPPAVAAAASRMRIEPLPTAALRRLYDTSNYGKLQLNNGLAL
TPQMGWNSWNFFACNINETVIRDTADALVSTGLADLGYNYVNIDDCWSNVKRGKKDQLLP
DPKTFPSGIKDLADYVHGKGLKLGIYSDAGIFTCQVRPGSLHHEKDDAAIFASWGVDYLK
YDNCYNLGIKPKDRYPPMRDALNSTGRQIFYSLCEWGQDDPALWAGKVGNSWRTTDDIQD
TWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTFAEYRAHFSIWALMKAPLLIGC
DVRNMTKETMEILSNKEVIQVNQDPLGVQGRRILGQGKNGCQEVWAGPLSGNRLAVVLWN
RCEESANIIVKLPSVGLDGSSPYSVRDLWKHETLSENVVGTFGAQVDVHDCKMYIFTPAV
TVASS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccgcgcctccgcctcccgttcctcctactggtggccctcgtcgtctcgccg
ccggcggtcgccgcggcggcgagccgaatgcggatcgagcccctccccaccgccgcgctg
cgccgcctctacgacacctccaactacggcaagctgcagctcaacaacggcctcgccctc
accccgcagatgggatggaacagctggaatttcttcgcctgcaacatcaacgagacggtc
atccgcgacacagctgacgcactagtctcgacggggctggctgatttgggctacaactat
gtaaatatcgatgattgttggtccaatgtaaaaagaggaaaaaaggatcaattgctacct
gacccaaaaactttcccttctggcatcaaagatcttgcggactatgtgcatgggaaaggt
ctaaagcttggtatctactctgatgctgggatttttacatgtcaagttcgacctggatcg
ctccatcatgaaaaggacgatgctgcaatatttgcttcatggggtgttgattacctgaag
tatgacaactgctacaatttgggaataaagcccaaggacaggtatcctccaatgcgtgat
gctttaaattcaactggacgccaaatattctactctctatgtgaatggggccaggatgat
ccagccttatgggctggcaaagttggtaacagttggcgcacaacagatgacatacaggat
acatggaaaagcatgactgatattgctgataagaataacaagtgggcatcatatgctgga
cccggtggatggaatgacccggatatgctggaagtcgggaatggtggcatgacctttgca
gagtatcgtgcacattttagcatctgggcacttatgaaggcccctctcttaattggttgc
gatgtcagaaacatgactaaagaaacaatggaaatattgagcaacaaagaagtaattcaa
gtaaatcaagatcctcttggagttcaaggaagaagaattttaggtcaagggaaaaatgga
tgccaagaggtgtgggctggccccctctctggtaaccgtctggctgttgttttatggaac
cgctgtgaggagtctgccaatattatagtaaaattgccatctgtaggccttgatggttca
tctccctattctgttagagatctgtggaagcatgaaactctatcagagaacgttgttgga
acttttggggcgcaagttgacgtgcatgactgcaaaatgtatattttcactcccgccgtc
accgttgcatcaagttga

DBGET integrated database retrieval system