KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0694000-01Help
Entry
Os07t0694000-01   CDS       T02163                                 

Gene name
Os07g0694000
Definition
Similar to Phospholipase C (Fragment).
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Os07t0694000-01 (Os07g0694000)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Os07t0694000-01 (Os07g0694000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Os07t0694000-01 (Os07g0694000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(29547997..29548662,29547689..29547934,29547355..29547593,29547100..29547217,29546654..29546800,29546491..29546577,29546089..29546382))
AA seq 598 aa AA seqDB search
MGTYKCCLIFKRRFRWNDAPPPDDVRALFANHSAGGGPHMAADGLRAYLQATGQDGDVDM
ERLVEQIRQLQGRGGRIPRVGRALPLLTVDDFHRFLFSHELNPPIRHGQGQVHHDMAAPL
SHYFIYTGHNSYLTGNQLSSDCSDLPIIRALQRGVRVIELDMWPNSSKDDISILHGRTLT
TPVSLLKCLLSIKQHAFEASPYPVIITLEDHLTPDLQDKAAKMVLEVFGDILYYPDKDHL
KEFPSPQDLKGRVLLSTKPPREYLQAKDGNAATIKEDAKAAATDDAAWGKEVPDIHSQIH
SATKHDQREDDDDTDEDEDDEEEEQKMQQHLAPQYKHLITIKAGKPKGTLLDALQSDPEK
VRRLSLSEQQLAKLADHHGTEIVRFTQRNLLRIYPKGTRVTSSNYNPFLGWVHGAQMVAF
NMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTDPEVFDPKKSLSPKKTLKVKVYMGDG
WRMDFTQTHFDQYSPPDFYARVGIAGVPADSVMKRTRAIEDNWVPVWEEDFTFKLTVPEI
ALLRVEVHEYDMSEKDDFGGQTVLPVSDLIPGIRAVALHDRKGIKLNNVKLLMRFEFE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgtacaagtgctgcctcatcttcaagcgccgcttccgctggaacgacgcgccg
ccgcccgacgatgtccgcgccctcttcgccaaccactccgccggcggtggcccccacatg
gccgccgacggcctccgcgcctacctccaggccaccggccaggacggcgacgtggacatg
gagcggctggtggagcagatccggcagctgcaggggcgcggcgggcgcatcccgcgggtg
gggcgggcactcccactcctgacggtggacgacttccaccgattcctcttctcccacgag
ctgaacccacccatccggcacgggcaggggcaggtgcaccacgacatggccgccccgctc
tcccactacttcatctacaccggccacaactcctacctcaccggcaaccagctcagcagc
gactgcagcgacctccccatcatcagggctctccagaggggcgtccgcgtcatcgagctc
gacatgtggcccaactcctccaaggatgacatcagcatcctccatggcaggacgctcacc
accccggtctccctcctcaaatgcctcctctccatcaagcaacacgcctttgaggcctcc
ccttacccggttatcatcacgctcgaagaccacctcacccccgatctccaggacaaagca
gccaagatggttcttgaagttttcggcgacatcctctactaccctgacaaagatcacctc
aaagagttcccttcgcctcaagacctcaagggccgtgtcctcctctccaccaagcccccc
agggagtaccttcaagccaaggatggtaatgctgccaccatcaaagaggacgccaaggcc
gccgccactgacgatgccgcatggggaaaagaagtcccagatattcactctcaaatccac
tctgccactaaacatgaccaaagagaagatgacgacgacaccgatgaagacgaagatgac
gaggaggaggagcagaaaatgcaacagcatctagctccacagtacaaacaccttattacc
atcaaagcaggaaagccaaaaggtactctacttgatgccttacagagtgacccagaaaag
gttagaaggctcagtttgagcgagcaacaacttgccaaattggcagatcatcatggtacc
gaaattgtaaggttcacacagagaaacctactgaggatatacccaaagggcactcgggtc
acatcatccaactataatccatttcttggttgggtgcatggtgctcagatggtagcgttc
aatatgcagggatatggaagagctctttggttgatgcatggattttataaagctaatggt
ggctgtggttatgtgaagaaaccagatttcttaatgcaaactgatccagaggtttttgac
ccaaaaaaatccctatctcccaagaaaaccttgaaggtgaaagtatacatgggggatggt
tggcggatggacttcacgcagacccactttgatcaatattctcctccagacttttatgca
cgggtggggatagcgggagtaccagcggactcggtgatgaagagaacgagggcgatagag
gataactgggtgccggtgtgggaggaggatttcaccttcaaactgaccgtgccggagatc
gcgttgctgcgggtggaggtgcacgagtacgacatgtcggagaaggacgacttcggcggc
cagacggtgctgccggtgtcggatctcatcccggggatccgagcggtggcactccacgac
cgcaaagggatcaagttgaacaacgtcaagcttctcatgcgcttcgagtttgaatga

DBGET integrated database retrieval system