KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0111200-01Help
Entry
Os08t0111200-01   CDS       T02163                                 

Gene name
Os08g0111200
Definition
Beta-glucosidase, GBA2 type domain containing protein.
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Os08t0111200-01 (Os08g0111200)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Os08t0111200-01 (Os08g0111200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Os08t0111200-01 (Os08g0111200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr08:complement(join(586000..586029,585653..585769,585259..585315,585073..585143,584812..584911,584645..584715,584464..584564,584247..584350,584092..584145,583948..584003,583577..583724,583308..583495,583101..583171,582928..583000,582668..582729,582141..582538,580466..581551))
AA seq 928 aa AA seqDB search
MGSSELEETKAVLHMDCEKPPAISWERTFDDEGKKVAMFSMTLNDMMAIVPLMIKMLGLN
LKDNAKGLASVYDPLKKWMDNCYRGVPLGGIGAGSIGRSYRGYFQQFQIFPSIYEEKPIL
ANQFSAFISRPDGKRYSTVLSAPNADVLKGIDKAGIGSWDWKLKEKNCTYHGLFPRSWTV
YNGEPDPEIKITCRQISPFIPHNYKESSFPVAVFTFTLHNSGSTPADVTLLFTWANSVGG
KSELTGNHKNSRMTTADGRPPVTFAIASRETDGVRVTGCPRFTMGPSNSGDVTAKDMWDQ
INKNGSFVGDGNAAAAATGASRPGSSIGAAVAATTTVAAGGARAVSFALSWSCPEVKFPA
GRTYHRRYTKFHGTDRDAAAERLAHDALLEHMKWESQIEEWQRPILQDKSLPEWYPITLF
NELYYLNAGGTIWTDGQPPKNTSLSSATEPFNLDTFSTVANGGSAVDGILSTVAVAAARS
NTAAAAAAAMGTALLRDGEENVGQVLYLEGMEYNMWNTYDVHFYASFALLSLFPELELNL
QRDFVRGVLLHDPCLRRTLDGATVARKVLGAVPHDMGLNDPWFEVNAYMLHDPVRWKDLN
PKFVLQVYRDVVATGNAGFAEAAWPAVYLAMAYMDQFDRDGDGMVENEGRPDQTYDLWSV
SGVSAYTGGLWVAALQAAAAMAGIVGDGAAEAYFRGRYHRARRVYTDELWNGGYFNYDNS
GGATSSSIQADQLAGQWYARACGLEPIVDGDKARRALATVLDYNVMRVKGGAIGAVNGMR
PDGAVDASSTQSKEVWPGVTYAVAAAMIHEGMPEAAFKTAKGIHDAGWGKHGFGYAFQTP
ESWTADGGYRALHYMRPLGVWAMQWALSPPVLHKEHRVAAVAASPEDAALGQEKFDKVAS
MLRLPEEQQHKGILRALYDTLRQLLLPS
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgggaagttcagaattggaggaaaccaaggcagtcctgcacatggattgtgaaaagcca
ccagcaatatcttgggagaggacatttgatgatgaaggaaagaaggttgcaatgtttagc
atgaccttgaatgacatgatggcaattgtgccgttgatgattaaaatgctgggactaaac
ctgaaagacaatgcaaaaggcctggcttcagtgtatgatccactgaagaaatggatggac
aactgctaccgcggtgtacccctcggtgggattggtgcagggagcatagggagaagctac
aggggatattttcagcagtttcagatattccccagtatatatgaagagaagcctatccta
gcaaatcaattttcagcattcatttcgcgccctgacggaaagagatactcgacagtgttg
tcggcaccgaatgccgatgtcctcaagggaatcgataaagctggcattggatcctgggac
tggaagctgaaagagaagaattgcacttaccatggcttgttcccaagatcatggacagta
tacaatggtgaacctgaccctgaaattaaaataacttgccgtcagatatcaccgttcatt
cctcacaactacaaggagagcagcttccctgttgcagttttcacttttacgttacacaat
tctggaagcacacctgcagatgtaacactgctcttcacatgggcaaattcggttggaggg
aaatctgaactgaccgggaatcataagaactccagaatgacgacggcggatgggcgccct
ccggtgacgttcgcgatcgcgtcgcgggagaccgacggcgtccgcgtcaccggctgcccg
cgcttcacgatgggaccatccaactccggcgatgtcacggcgaaggacatgtgggatcag
atcaacaagaatggttcgttcgtcggggacggcaatgcggcggcggcggcgacgggagcg
tcgaggcccgggtcgtccatcggagcggcggtggcggcgacgacgacggtggcggcgggt
ggcgcgcgcgcggtgtcgttcgcgctgtcgtggtcgtgccccgaggtgaagttcccggcg
gggagaacctaccacaggaggtacaccaagttccatggcaccgatcgcgacgcggctgct
gagcgcctggcccacgatgctcttcttgaacacatgaaatgggagtcccagatcgaggag
tggcagaggcctattctgcaggacaagagcctacctgaatggtatccaattacactgttc
aacgagctctactacctcaacgctggaggcaccatttggacagatgggcagcctccgaag
aacaccagcctttcgtcagcgactgagccgttcaacctcgacacgttcagtacagtcgcc
aacggcggcagcgcggtcgacggcattttgagcacggtggcggtggcggcggcgcggtcg
aacacggcggcggcggcggcggcggcgatgggcacggcgctgctgcgcgacggcgaggag
aacgtggggcaggtgctgtacctggaggggatggagtacaacatgtggaacacctacgac
gtccacttctacgcctccttcgccctcctctccctcttccccgagctcgagctcaacctc
cagcgcgacttcgtccgcggcgtcctcctccacgacccctgcctccgccgcacccttgac
ggcgccaccgtggcgcgcaaggtgttgggagcggtgccacatgacatggggctgaacgac
ccgtggttcgaggtgaacgcgtacatgctgcacgacccggtgaggtggaaggacctcaac
ccaaagttcgtgctgcaggtgtaccgcgacgtggtggcgacggggaacgccggcttcgcg
gaggcggcgtggccggcggtgtacctggccatggcgtacatggaccagttcgaccgcgac
ggcgacgggatggtcgagaacgagggccgccccgaccagacctacgacctgtggtcggtg
tccggcgtcagcgcctacaccggcggcctctgggtggcggcgctccaggccgccgcggcc
atggcgggcatcgtcggcgacggcgccgccgaggcctacttccgggggaggtaccaccgc
gccaggcgcgtgtacacagacgagctctggaacggcggctacttcaactacgacaacagc
ggcggcgccaccagctcgtcgatccaggccgaccagctcgccggtcagtggtacgcgcgg
gcgtgcgggctggagccgatcgtggacggcgacaaggcgcggcgagcgctggcgacggtg
ctcgactacaacgtcatgcgggtgaagggcggcgccatcggcgccgtcaacgggatgcgg
ccggacggcgccgtggacgcgtcgtcgacgcagtccaaggaggtgtggcccggggtgacg
tacgccgtcgccgccgcgatgatccacgaggggatgccggaggcggcgttcaagacggcc
aagggcatccacgacgccggctggggcaagcacggcttcggctacgcgttccagacgccg
gagtcgtggacggccgacggcggctaccgggcgctgcactacatgcgcccgctcggcgtc
tgggcgatgcagtgggcgctgtcgccgccggtgctccacaaggagcacagggtggcggcg
gtggcggcctcgccggaggacgccgcactggggcaggagaagttcgacaaggtagcgagc
atgctgaggctgcctgaggagcagcagcacaaggggatccttcgggcgctctatgatact
cttcgccaattgctgctcccatcatga

DBGET integrated database retrieval system