KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0135900-01Help
Entry
Os08t0135900-01   CDS       T02163                                 

Gene name
Os08g0135900
Definition
Similar to Tryptophan synthase beta chain 1 (EC 4.2.1.20) (Orange pericarp 1) (Fragment).
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Os08t0135900-01 (Os08g0135900)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Os08t0135900-01 (Os08g0135900)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Os08t0135900-01 (Os08g0135900)
Enzymes [BR:dosa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Os08t0135900-01 (Os08g0135900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr08:join(2029786..2030130,2030829..2031185,2031295..2031737,2031819..2031913,2032646..2032821)
AA seq 471 aa AA seqDB search
MAAAVGNPNAAAAASISASRVGAGALRAGGLRVAAGRRGAGAVVAAAMRPAKAVASPAKE
AAGEVNGAASGGFARPDAFGRFGKFGGKYVPETLMHALTELEAAFHALAGDEDFQKELDG
ILKDYVGRETPLYFAERLTEHYKRADGTGPMIYLKREDLNHTGAHKINNAVAQVLLAKRL
GKERIIAETGAGQHGVATATVCARFGLQCIIYMGAQDMERQALNVFRMKLLGAEVRAVHS
GTATLKDATSEAIRDWVTNVENTHYILGSVAGPHPYPMMVREFHKVIGKETRRQAMEKWG
GKPDVLVACVGGGSNAMGLFHEFVDDQDIRMIGVEAAGYGVDTDKHAATLTKGEVGVLHG
SLSYVLQDDDGQVIEPHSISAGLDYPGVGPEHSFLKDIGRAEYDSVTDQEALDAFKRVSR
LEGIIPALETSHALAYLEKLCPTLPDGVRVVVNCSGRGDKDVHTASKYLDV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgtcgggaaccctaacgcggccgccgctgcgtcgatctcggcgtcgagg
gtcggtgcgggggcgttgcgcgcggggggcttgagggtggcggcggggaggaggggagcg
ggggctgtggtggcggcggcaatgcggccggcgaaggcggtggcgtcgccggcgaaggag
gcggccggggaggtgaacggggcggcgtcgggggggttcgcgaggcccgacgcgttcggg
aggttcgggaagttcgggggcaagtacgtgcccgagacgctgatgcatgcgctcaccgag
ctcgaggccgcgttccatgccctcgccggcgacgaagatttccagaaagaacttgatggt
attctcaaggattacgtcggccgggagaccccgctgtactttgcggagcgattgactgag
cactacaagcgcgctgatggcacaggccccatgatttacctcaagagggaggatcttaac
cacactggcgcccacaagatcaacaatgctgtcgctcaagtcttgcttgccaagcggctt
gggaaggaacgtatcatcgccgagactggcgccggccagcacggtgttgccactgccacg
gtgtgcgcgaggtttgggctgcagtgcatcatctacatgggtgctcaggatatggagagg
caggcacttaatgttttcaggatgaagcttcttggagcagaggtgagggcagtacattct
gggacagcaactttgaaggatgccacctcggaggccatccgtgactgggtcaccaatgtt
gagaacactcactacattttgggatcagttgctggtccgcatccatacccgatgatggtg
agagagttccataaggtgattggcaaggagacccgtagacaggccatggagaagtggggt
ggcaagcctgatgtcttggttgcttgtgttggtggtggatcaaacgccatgggtctcttc
catgagttcgttgatgatcaagatataagaatgattggagtggaggctgctggctatggt
gtagacactgacaaacatgctgccactttgacaaagggagaagtgggagttctccatgga
tcattgagctatgtgttgcaggatgatgatggacaagttattgaaccccactccattagt
gctgggctggactaccctggtgttgggcctgagcatagctttttgaaggatattggacgt
gctgaatatgacagcgtgacagatcaggaggcactggatgctttcaagcgcgtctctcgg
ctggagggcatcatccctgctctggagacgtcccatgcgctcgcctacctggagaagctc
tgcccaacgctgcccgacggcgtgagggtggtggtgaactgcagtggaagaggagacaag
gatgtccacacagccagcaagtaccttgatgtctga

DBGET integrated database retrieval system