KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0135900-01Help
Entry
Os08t0135900-01   CDS       T02163                                 

Gene name
Os08g0135900
Definition
(RAP-DB) Similar to Tryptophan synthase beta chain 1 (EC 4.2.1.20) (Orange pericarp 1) (Fragment).
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00260  Glycine, serine and threonine metabolism
dosa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01230  Biosynthesis of amino acids
Module
dosa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Os08t0135900-01 (Os08g0135900)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Os08t0135900-01 (Os08g0135900)
Enzymes [BR:dosa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Os08t0135900-01 (Os08g0135900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
RAP-DB: Os08t0135900-01
Position
chr08:join(2029786..2030130,2030829..2031185,2031295..2031737,2031819..2031913,2032646..2032821)
AA seq 471 aa AA seqDB search
MAAAVGNPNAAAAASISASRVGAGALRAGGLRVAAGRRGAGAVVAAAMRPAKAVASPAKE
AAGEVNGAASGGFARPDAFGRFGKFGGKYVPETLMHALTELEAAFHALAGDEDFQKELDG
ILKDYVGRETPLYFAERLTEHYKRADGTGPMIYLKREDLNHTGAHKINNAVAQVLLAKRL
GKERIIAETGAGQHGVATATVCARFGLQCIIYMGAQDMERQALNVFRMKLLGAEVRAVHS
GTATLKDATSEAIRDWVTNVENTHYILGSVAGPHPYPMMVREFHKVIGKETRRQAMEKWG
GKPDVLVACVGGGSNAMGLFHEFVDDQDIRMIGVEAAGYGVDTDKHAATLTKGEVGVLHG
SLSYVLQDDDGQVIEPHSISAGLDYPGVGPEHSFLKDIGRAEYDSVTDQEALDAFKRVSR
LEGIIPALETSHALAYLEKLCPTLPDGVRVVVNCSGRGDKDVHTASKYLDV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgtcgggaaccctaacgcggccgccgctgcgtcgatctcggcgtcgagg
gtcggtgcgggggcgttgcgcgcggggggcttgagggtggcggcggggaggaggggagcg
ggggctgtggtggcggcggcaatgcggccggcgaaggcggtggcgtcgccggcgaaggag
gcggccggggaggtgaacggggcggcgtcgggggggttcgcgaggcccgacgcgttcggg
aggttcgggaagttcgggggcaagtacgtgcccgagacgctgatgcatgcgctcaccgag
ctcgaggccgcgttccatgccctcgccggcgacgaagatttccagaaagaacttgatggt
attctcaaggattacgtcggccgggagaccccgctgtactttgcggagcgattgactgag
cactacaagcgcgctgatggcacaggccccatgatttacctcaagagggaggatcttaac
cacactggcgcccacaagatcaacaatgctgtcgctcaagtcttgcttgccaagcggctt
gggaaggaacgtatcatcgccgagactggcgccggccagcacggtgttgccactgccacg
gtgtgcgcgaggtttgggctgcagtgcatcatctacatgggtgctcaggatatggagagg
caggcacttaatgttttcaggatgaagcttcttggagcagaggtgagggcagtacattct
gggacagcaactttgaaggatgccacctcggaggccatccgtgactgggtcaccaatgtt
gagaacactcactacattttgggatcagttgctggtccgcatccatacccgatgatggtg
agagagttccataaggtgattggcaaggagacccgtagacaggccatggagaagtggggt
ggcaagcctgatgtcttggttgcttgtgttggtggtggatcaaacgccatgggtctcttc
catgagttcgttgatgatcaagatataagaatgattggagtggaggctgctggctatggt
gtagacactgacaaacatgctgccactttgacaaagggagaagtgggagttctccatgga
tcattgagctatgtgttgcaggatgatgatggacaagttattgaaccccactccattagt
gctgggctggactaccctggtgttgggcctgagcatagctttttgaaggatattggacgt
gctgaatatgacagcgtgacagatcaggaggcactggatgctttcaagcgcgtctctcgg
ctggagggcatcatccctgctctggagacgtcccatgcgctcgcctacctggagaagctc
tgcccaacgctgcccgacggcgtgagggtggtggtgaactgcagtggaagaggagacaag
gatgtccacacagccagcaagtaccttgatgtctga

DBGET integrated database retrieval system