KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0157000-00Help
Entry
Os08t0157000-00   CDS       T02163                                 

Gene name
Os08g0157000, MAPK2, MITOGEN-ACTIVATED_PROTEIN_KINASE_2
Definition
Similar to Mitogen-activated protein kinase 4.
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Os08t0157000-00 (Os08g0157000)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Os08t0157000-00 (Os08g0157000)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os08t0157000-00 (Os08g0157000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr08:join(3307639..3307865,3308067..3308196,3308693..3308830,3308960..3309292,3309624..3309807,3309991..3310163)
AA seq 394 aa AA seqDB search
MRMEGGGGGGHGHHGGGGGGHGHHGGIGGGEAQIKGTLTHGGRYVQYNVYGNLFEVSSKY
VPPIRPVGRGACGIICAVVNAQTRQEVAIKKIGNAFDNQIDAKRTLREIKLLRHMDHDNV
ISIKDIIRPPRRENFNDVYIVYELMDTDLHHLLRSNQPLTDDHCQYFLYQVLRGLKYVHS
ANVLHRDLRPSNLLLNAKCDLKIGDFGLARTTNETDFMMEYVVTRWYRAPELLLNCSEYT
AAIDIWSVGCILGEIVTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRS
LPQYPKQQFRARFPTMSSGAMDLLERMLVFDPSKRITVDEALCHPYLASLHEIYDEPVCP
APFSFDFEQPSLTEEDIKEIIWREALKFNPEPIH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatggagggcggcggcggcggcggccatggccatcacggcggcggcggcggtggc
catggccatcacggtggcatcggaggaggggaggcgcagatcaaggggacgctgacgcac
ggcgggaggtacgtgcagtacaacgtgtatggtaacctgttcgaggtttcgtccaagtac
gtccctcccatccgccccgtcggccgcggcgcctgcggcatcatctgtgcggttgtgaat
gcgcagactcgtcaggaggtggcaatcaagaagatcggcaacgcgttcgacaaccagatc
gacgccaagcgcaccctgcgagagatcaagctgcttcggcacatggatcatgataatgtc
atctcaataaaggacatcatacggccaccaaggagggagaacttcaatgatgtctacatt
gtctatgagctcatggacactgatcttcaccaccttcttcgatcaaaccagccactaaca
gatgatcactgtcagtattttctctatcaggtactacgaggattgaagtatgtgcattca
gcaaatgtcttgcacagagacctcaggccaagtaatttgctgctgaatgcgaaatgcgat
cttaagatcggagactttggattagcaaggaccacaaatgaaactgacttcatgatggag
tatgttgttactcgatggtacagggcacctgaactcctgctaaactgctcagagtacact
gcagctattgatatctggtcggtaggctgcatccttggtgagatcgttacaagggagcct
ttgtttcctggaaaggattatgtccatcagctgaggctaataactgagttaataggctca
cctgatgactcgagccttgggtttcttcgaagcgacaacgcccgcagatatgtgaggtcg
cttcctcaataccccaagcaacaattccgtgcacggttccccactatgtctagtggtgcc
atggatttgcttgagaggatgcttgtgtttgatcccagcaaaaggattactgttgatgaa
gctctgtgccatccatacttggcatcccttcatgagatatatgatgaaccagtctgccca
gcgcctttcagcttcgatttcgagcagccgtcgctcaccgaagaagatatcaaggagatc
atatggagggaggcacttaagttcaaccctgaaccaattcactag

DBGET integrated database retrieval system