KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0176800-01Help
Entry
Os08t0176800-01   CDS       T02163                                 

Gene name
Os08g0176800
Definition
Similar to mRNA-associated protein mrnp 41 (Rae1 protein homolog).
Orthology
K14298  
mRNA export factor
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os08t0176800-01 (Os08g0176800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr08:complement(join(4501670..4501720,4501452..4501538,4501306..4501371,4501016..4501209,4500408..4500549,4500206..4500286,4499660..4499788,4498640..4498717,4498096..4498167,4497336..4497416,4497199..4497246))
AA seq 342 aa AA seqDB search
MATLGLAPNMNPNKSFEVLPNPGDSVSSLSFSPKSNLLVATSWDNQVRCWEIVGGSSQPK
ASISHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQAQTVAMHDAPVKEIAWIPQM
NLLVSGSWDKTLRYWDTRQSNPVHVQQLPERCYALTVNYPLMIVGTADRNLVVFNLQNPQ
TEFKRIQSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHIDDSQQSKNFTFKCHREGNDI
FSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAFSRCPLPIPCSTFNSDGSIFAYA
VCYDWSRGAENHNPATAKTSIYLHSPQESEVKGKPRIATSRK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcttggtcttgccccaaacatgaatccaaacaagtcatttgaggtactgcct
aatccaggtgactccgtatcgagcctcagttttagcccaaagagcaaccttctggtggca
acttcctgggataaccaggtgcggtgctgggagattgttggtgggagtagtcaaccaaag
gcatctatatcgcatgaccagccagtcctctgttcagcttggaaggatgatggaactact
gtgttctctggaggctgtgataaacaagtaaaaatgtggcctctgttgtctggtgggcag
gctcagactgttgcaatgcatgacgcacctgtcaaggagatcgcttggattcctcaaatg
aatcttcttgtctctggaagctgggataagactctaaggtattgggacacaaggcaatca
aatcctgtccatgttcagcaacttcctgagcgctgttacgcacttacagtgaattatccc
cttatgattgtgggaactgctgatcgtaatctggtcgtcttcaacttgcagaatcctcag
acggagttcaagcgcatccaatcgccactcaaataccagactaggtgtcttgctgcattc
ccggatcaacaaggatttttggtgggttccatagaaggaagagttggtgtgcatcatatt
gatgactcacagcaaagcaaaaatttcacgttcaaatgtcacagggaagggaatgatatt
ttctctgtcaattcactcaattttcacccagttcatcacacgtttgcaactgctggatca
gatggcgcatttaatttctgggataaggatagcaaacaaagactgaaggcttttagtcgg
tgccctcttcctattccttgcagtaccttcaacagtgatgggtcgatatttgcttatgca
gtctgctatgactggagccgtggggctgaaaaccacaaccctgccactgcaaagacatcc
atctatcttcacagtccacaggaatctgaggttaaagggaagccgagaatcgcaacaagt
agaaagtga

DBGET integrated database retrieval system