KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0241600-01Help
Entry
Os08t0241600-01   CDS       T02163                                 

Gene name
Os08g0241600
Definition
Similar to apospory-associated protein C.
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os08t0241600-01 (Os08g0241600)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Os08t0241600-01 (Os08g0241600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:complement(join(8594165..8594329,8592744..8592818,8592340..8592396,8592099..8592259,8591848..8591988,8591180..8591282,8590996..8591095,8590688..8590899))
AA seq 337 aa AA seqDB search
MAAPPPSSPSPPPAAAAAATQQTQPHPQTPFYELVKGNSGIEKVLLRGTRGFSAEVYLYG
AQVTSWKNDHAEELLFVSSKAIFKPPKAIRGGIPICFPQFGTHGNLEQHGFARNRLWTID
DNPPPLPVNPAIKSFVDLILRPSDEDLKIWPHSFEFRLRVALGPNGDLSLTSRIRNTNTD
GRSFSYTFAYHTYFSVSDISEVRVEGLETMDYLDNLKGKERFTEQGDAIVFESEIDKVYL
AAPSKIAIIDHEKKRTFVLTKEGLPDAVVWNPWDKKAKAMQDFGDGEYKHMLCVEPAAVE
KPITLKPGEEWKGRLALSAVPSSYCSGQLDPLKVLQG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccgccgccttcctccccgtcgccgccgccggcggcggcggctgcggcgacg
cagcagacgcagccgcacccgcagacgccgttctacgagctcgtcaagggaaactccggc
atcgagaaggtccttctccgcggcacgcgcggcttctccgctgaggtctatctttatgga
gctcaagtaacctcatggaagaatgaccatgcggaggagttgctttttgtcagcagtaag
gctattttcaaacctccaaaagccattcgtggtgggatacccatttgcttcccccaattt
ggaacacatggaaatcttgaacaacatggatttgcaaggaaccgattatggactattgat
gataatccaccacctttaccagtaaaccctgctattaaatcttttgttgatctgattctg
aggccttctgacgaggatttaaagatctggcctcacagttttgagttccgcttgagagtt
gctcttggtcctaatggggatttgagtctcacttctcgaattaggaataccaacactgat
ggaagatctttctcttacacatttgcatatcacacatacttctctgtctctgacatcagt
gaagtgcgtgttgaagggctggaaacaatggactaccttgacaatttgaagggaaaggag
cgttttacagagcaaggggatgctattgtatttgaatcagagattgataaggtatacctt
gctgcaccttcaaaaattgcaattattgatcatgaaaagaaaaggacatttgtcttgaca
aaagaaggacttccagatgctgttgtttggaacccttgggacaagaaggcaaaagctatg
caagattttggagatggagaatacaaacacatgctttgtgtggagcctgcagctgttgag
aagcctattactctgaagccaggtgaagagtggaaaggaagacttgcactctcagctgtt
ccttccagttactgtagtgggcagttagatccattgaaggtccttcaaggttga

DBGET integrated database retrieval system