KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0243500-01Help
Entry
Os08t0243500-01   CDS       T02163                                 

Gene name
Os08g0243500
Definition
Similar to NADPH-cytochrome P450 oxydoreductase isoform 2.
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Os08t0243500-01 (Os08g0243500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:join(8760403..8760579,8761338..8761397,8761517..8761593,8761824..8761965,8762079..8762115,8762195..8762264,8762364..8762555,8762664..8762756,8762888..8763116,8763204..8763287,8763384..8763535,8763622..8763718,8763919..8764068,8764156..8764233,8764325..8764447,8764545..8764658,8764761..8764841)
AA seq 651 aa AA seqDB search
GRKRKREEAERSAAAVAGVGKGGKNASAAAGEEAGGADGRKRVTVFFGTQTGTAEGFAKA
LAEEAKSRYDKAIFKVVDLDEYAMEDEEYEERLKKEKISLFFVATYGDGEPTDNAARFYK
WFTEGNERGVWLNDFQYAIFGLGNRQYEHFNKVAKVVDELLVEQGGKRLVPVGLGDDDQC
IEDDFNAWKETLWPELDQLLRDENDVSTGTTYTAAIPEYRVEFVKPDEAAHLERNFSLAN
GYAVHDAQHPCRANVAVRRELHTPASDRSCTHLEFDIAGTGLTYETGDHVGVYTENCLEV
VEEAERLLGYSPEAFFTIHADKEDGTPLGGGSLAPPFPSPITVRNALARYADLLNSPKKS
ALVALATYASDSTEADRLRFLASPAGKDEYAQWVVASQRSLLEVMAEFPSAKPPLGVFFA
AVAPRLQPRYYSISSSPSMAPTRIHVTCALVHEKTPAGRVHKGVCSTWIKNAIPSEETKD
CSWAPVFVRQSNFKLPADPSVPVIMIGPGTGLAPFRGFLQERLSQKQSGAELGRSVFFFG
CRNSKMDFIYEDELNTFLEEGALSELVLAFSREGPTKEYVQHKMSQKASEIWDMISQGGY
IYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gggcggaagcggaagagggaggaggcagagaggtcggcggcggccgtggctggggtgggg
aagggcgggaagaatgcctccgcggcggccggggaggaggccggcggcgccgacgggagg
aagcgggtcaccgtcttcttcggcacgcagaccggcaccgccgagggcttcgccaaggca
ctcgctgaggaggctaagtcaagatacgacaaggcgatattcaaagttgtggacttggat
gagtatgcgatggaggatgaggagtacgaggagagattgaagaaggagaagatatcgttg
ttcttcgttgcaacgtacggagatggtgaaccgactgacaatgctgctaggttctataaa
tggttcactgagggaaatgagaggggtgtttggttgaatgacttccagtatgctattttt
ggtcttggcaatcggcagtatgagcatttcaacaaggttgccaaggttgttgatgagctc
ctagttgagcaaggtggaaaacgtcttgttccggttggtcttggagatgatgatcaatgc
attgaggatgacttcaacgcatggaaagaaactctctggccagaattggatcagttactt
cgggatgaaaatgatgtttcaacaggcactacctacacagctgccattcctgaataccgg
gttgaatttgttaagcctgatgaggcagcccatttggagagaaatttcagtcttgcaaac
ggttatgcggttcatgatgctcagcatccttgccgggccaacgtggctgtgcgacgggaa
ctccacactcctgcttctgatcgttcatgcactcacttggagtttgacattgctggcact
ggtcttacgtatgaaaccggtgaccatgttggtgtatacacagagaactgcctcgaggtt
gtagaggaggcagagaggttgttaggctactccccagaggcttttttcaccatccatgca
gacaaagaggacggtacaccactaggtggtggttctctggctcctccattcccttccccg
attactgtgaggaatgcgcttgctagatatgcggatcttctgaattcgccgaagaagagt
gctttggttgcattagctacttatgcttcagattctactgaagctgatcgtctgaggttc
ttggcctctcctgctggaaaggatgagtatgctcaatgggttgttgcgagtcaaagaagt
ctattagaagtgatggcagagttcccttcagcaaagcctccactaggagtcttctttgca
gccgttgctcctcgtcttcagccgagatactactcaatttcatcttcacctagcatggca
cctaccagaattcatgttacatgtgcacttgtccatgaaaaaacacctgctggaagggta
cataagggagtctgctcaacatggattaagaatgctattccatcagaagagacaaaggac
tgcagctgggctccagtttttgtgagacaatcaaacttcaaactgcctgctgatccttca
gtaccggttatcatgattggcccaggaactggtcttgctcctttccgcggattcttgcag
gagaggctgtctcaaaaacaatcaggagctgagcttggtcgctccgtattcttctttgga
tgcagaaacagcaagatggacttcatctatgaggatgagctgaacactttccttgaggaa
ggagcattgtccgagctggttctcgccttctctcgtgagggccctacgaaggaatacgtg
cagcacaaaatgtcgcagaaagcttccgaaatctgggacatgatctcccagggtggttac
atttacgtctgtggtgatgccaaaggcatggccagagatgtacatagagttctccacacc
attgtacaggaacagggatcacttgacagctctaaggctgagagctttgtgaagagcctc
caaacggagggtaggtatctgagagatgtgtggtaa

DBGET integrated database retrieval system