KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0248800-01Help
Entry
Os08t0248800-01   CDS       T02163                                 

Gene name
Os08g0248800
Definition
Similar to Aspartate carbamoyltransferase 3, chloroplast precursor (EC 2.1.3.2) (Aspartate transcarbamylase 3) (ATCase 3).
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dosa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dosa00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:complement(join(9075389..9075821,9073870..9074009,9073014..9073187,9072673..9072909,9071916..9072023))
AA seq 363 aa AA seqDB search
MAAARATLPLPRVPAPSPRPQLRPFPSLPARRGAVACGAGSAAAGVAASLRLGDVIEAQQ
FDRDALTEIFEVAREMEALERGSSSRGAGRSRVLEGYLMATLFYEPSTRTRLSFEAAMRR
LGGEVLTTENAREFSSAAKGETLEDTIRTVEGYSDIIVLRHFESGAARRAAATADIPVIN
AGDGPGQHPTQALLDVYSIEREIGTLDGIKLGLVGDLANGRTVRSLAYLIAKYQNIKIYF
VSPDVVKMKDDIKEYLTSQGVEWEESSDLLEVASKCDVIYQTRIQKERFGERIDLYEAAR
GKYIVDKKVLDVLPKHAVIMHPLPRLDEITIDVDSDPRAAYFRQAKNGLYIRMALLKLLL
VGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcccgcgccaccctcccgctcccgcgtgtccccgccccctcgccgaggccc
cagctcaggcccttcccctccctccccgctcgccgcggcgcggtggcatgcggcgccggc
tcggcggcggcgggggtcgcggcgtcgctgcggctcggggacgtgatcgaggcgcagcag
ttcgaccgggacgcgctgacggagatcttcgaggtggcgcgggagatggaggccctggag
cgcgggtcctcctcccgcggcgccgggaggagccgcgtcctcgaggggtacctcatggcc
acgctcttctatgagccgtccacgcgcacgcgcctctccttcgaggccgccatgcggcgg
ctcggcggggaggtgctcaccaccgagaacgcccgcgagttctcctccgccgccaagggc
gagaccctggaagataccataaggactgttgagggttattctgatattattgttctgaga
cattttgaaagtggggctgcaaggagagcagccgccactgcagacattccagttattaat
gcaggcgatgggccagggcaacatccaactcaggctttattggatgtctattcaatagag
agagaaattggcacactagatggaataaaacttggtttggttggagaccttgctaatgga
agaactgttcgttctctagcctatttgattgccaaataccaaaacattaagatatacttt
gtatctccagatgttgtaaaaatgaaggatgacatcaaggaatacttaacttctcaaggt
gttgagtgggaagaaagttcagatttgttggaggtggcatcaaaatgcgatgttatttat
caaacacgcattcaaaaagaaagattcggtgagaggatagatctttatgaagcagctcgt
ggtaagtacattgtggacaagaaggtcttagatgtgctgccaaaacatgctgttatcatg
catccccttccaaggcttgatgagatcacaatagatgttgacagtgatccgagagctgca
tattttagacaggccaaaaacggcctctacatcagaatggcgttgctcaaacttctgctt
gttggtcgctga

DBGET integrated database retrieval system