KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0304900-01Help
Entry
Os08t0304900-01   CDS       T02163                                 

Gene name
Os08g0304900
Definition
Similar to AtMMH-1 protein (F6D8.28 protein).
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Os08t0304900-01 (Os08g0304900)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Os08t0304900-01 (Os08g0304900)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Os08t0304900-01 (Os08g0304900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:join(12710929..12711157,12712241..12712292,12714013..12714070,12714846..12714914,12715006..12715131,12715448..12715498,12717005..12717082,12717855..12717938,12718035..12718070,12718158..12718604)
AA seq 409 aa AA seqDB search
MPELPEVEVARRALEEHCVGKRIVRCSAADDTKVIDGVAPPRLEAALVGRTISAARRKGK
NLWLALDSPPFPSFQFGMAGAIYIKGVELSKYKRSAVSPTEEWPLKYSKLLVVMDDGLEF
SFTDKRRFAKIRFLDNPEAVPPISELGPDALFEPLHLDDFVESLSRKKAPIKALLLDQSF
ISGIGNWIADEVLYQARIHPMQTASMISKEKCKALHQCIIEVIEKSLEVGCNSSQYPENW
IFHSREKKPGKKIDFITVGGRTSAYVPELQKLDGIDATASRAKISKEQSKSNKAAREVDD
DEEEAKPAKRGRKQLVKATHEIQEDEEDTKESKRGRKQPAKTSKGSWKKAHHSSEGSGDD
DSDDEAVDKVVAEQGKRRDPKQPAEAKSSSDKGGSAAPAKRPQRKKRQL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggtggcgcgacgggcgctggaggagcactgcgtcggg
aagaggatcgtgcggtgctcggctgcagatgacaccaaggtcatcgacggcgtcgccccg
ccgcggctggaggcagcgcttgtcgggaggaccatctccgctgctcgccgcaagggcaag
aatctgtggcttgcgcttgattctccgcccttcccttccttccagttcggaatggctgga
gctatttacatcaagggtgtggaactgagcaaatacaaaaggtctgcagtgagcccgact
gaggaatggcctttgaagtattccaagctgcttgttgtaatggatgatggtttggagttt
tccttcactgataagaggcgttttgcaaaaattcgctttcttgacaatccagaagctgtc
ccaccaatttctgagcttggaccagatgccttatttgaacctcttcatcttgatgatttt
gtagagtcactaagtaggaaaaaagctccaataaaagcccttttgcttgatcagagcttt
atatcaggaattggcaattggattgcagatgaagtgctttatcaggcaaggattcatcca
atgcaaacagcatcgatgatttctaaggagaaatgcaaggcactccatcagtgcattata
gaggtgattgaaaagtccttagaagttggttgcaacagcagtcagtatccagaaaactgg
atatttcactccagggagaagaaacccgggaagaaaattgacttcattacagttggtggc
aggacttcagcatatgtgccagagttgcagaagctggacgggattgatgcaacagcaagc
agagcgaaaataagcaaagaacagagcaaatcaaataaagctgctcgtgaagtggacgat
gatgaggaagaggctaaacctgccaagaggggaaggaagcaattagtgaaggcaacccat
gagatccaagaggatgaggaagatacaaaagaatcaaagagaggaaggaagcaaccagca
aagacatcgaagggctcgtggaagaaagctcatcattcttctgagggtagtggtgacgac
gacagtgatgatgaagcagttgataaggtggtcgcggaacaagggaagaggagggatcca
aagcaaccagcagaggcgaaaagctcgtcagacaaaggaggaagtgctgccccagcaaag
aggccacagaggaagaagcggcaattatag

DBGET integrated database retrieval system