KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0344100-01Help
Entry
Os08t0344100-01   CDS       T02163                                 

Gene name
Os08g0344100
Definition
Similar to Histone deacetylase.
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Os08t0344100-01 (Os08g0344100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:join(15554211..15554753,15556756..15557196,15557288..15557430,15557858..15557948,15558033..15558167,15558714..15558737)
AA seq 458 aa AA seqDB search
MAASGEGASLASAAGGEDGRRRRVSYFYEPSIGDYYYGQGHPMKPHRIRMAHSLVVHYGL
HRLLELSRPYPASDADIRRFHSDDYVAFLASATGNPALLDARAVKRFNVGEDCPVFDGLF
PFCQASAGGSIGAAVKLNRGDADITVNWAGGLHHAKKGEASGFCYVNDIVLAILELLKFH
RRVLYVDIDVHHGDGVEEAFFTTNRVMTCSFHKYGDFFPGTGHITDVGAGEGKHYALNVP
LSDGIDDDTFRDLFQCIIKKVMEVYQPDVVVLQCGADSLAGDRLGCFNLSVKGHADCLRY
LRSFNIPMMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNDYYEYFGPDYNLHIQP
RSVENLNSTKDLENIKSMILDHLSKIEHVPSTQFHDRPSDPEAPEQEEEDMDKRPPQRSR
LWSGGAYESDTEDPDNMKTETNDLSASSVMKDESNDDS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccggcgagggggcgtcgctggcgtcggcggcgggaggggaggacgggcgg
cggcggcgggtgagctacttctacgagccgtcgatcggggactactactacgggcagggg
cacccgatgaagccccatcgcatccgcatggcgcactcgctggtggtccactacggcctc
caccgcctcctcgagctctcccgcccctacccggcctccgacgccgacatccgccgcttc
cactccgacgactacgtcgccttcctcgcctccgccaccgggaaccccgccctgctcgac
gcccgcgccgtcaagcgcttcaacgtcggcgaggactgcccggtcttcgacggcctcttc
cccttctgccaggcctccgcggggggcagcatcggcgccgccgtcaagctcaaccgcggc
gacgccgacatcaccgtcaactgggcggggggcctccaccacgccaagaagggcgaggcc
tccggcttctgctacgtcaacgacatcgtcctcgccatcctcgagctcctcaagttccac
aggcgtgtgctatatgtagacattgatgtccaccatggagatggcgtggaggaagctttc
ttcactacgaatcgagtcatgacttgttcctttcacaagtatggggactttttccctggt
actgggcatatcactgatgttggagcaggcgaaggaaaacattatgctttaaatgtgccc
ctgagtgatggcattgatgatgatacctttcgtgatctgttccagtgcatcatcaaaaag
gtaatggaggtttatcagccagatgtagttgttctccagtgtggagccgactctttggct
ggagacaggttaggttgcttcaacctgtctgtgaaaggtcatgcagactgcctccgttac
cttaggtcattcaatattcctatgatggttttgggaggtgggggttacaccatcagaaat
gttgctcgctgctggtgctatgagactgcagttgctgttggagttgaacctgataacaag
ttaccttataatgactactatgagtactttggtcctgattataatctccatattcaaccc
agaagtgtggagaacctgaattcgactaaagacctggagaacataaagagcatgatattg
gatcatctctcaaaaattgagcatgttccgagcactcagttccatgacagaccatcagat
cctgaagctccagagcaggaagaggaggacatggacaagagaccacctcagcgcagtagg
ttatggagtggaggagcttatgaatctgatacagaggatcctgacaacatgaaaactgag
accaatgacttatctgccagctctgtcatgaaggatgaatcgaatgatgattcctag

DBGET integrated database retrieval system