KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0442300-01Help
Entry
Os08t0442300-01   CDS       T02163                                 

Gene name
Os08g0442300
Definition
Similar to Calcineurin subunit B.
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Os08t0442300-01 (Os08g0442300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:join(21552254..21552323,21552448..21552572,21552714..21552810,21552901..21553010,21553543..21553617,21554066..21554116)
AA seq 175 aa AA seqDB search
MGSTSSMLTQYDIEEVQDHCDHAFSQQEIVSLYHRFCQLDRNGGGFVSAEEFMTVPEFAV
NPLSQRLLRMLDGLNFKEFVAFLSAFSPRASLQQKIEFIFRVYDTDCNGKVAFDDILSIL
RDLSGSFMTEQQRQKVLIHVLEEAGYTKDSNFTLPDFMKILDNSDVKMEVEVPID
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggagcacctcgtcgatgctgacgcagtacgacatcgaggaggtccaggaccactgc
gaccacgccttctcgcagcaggagatcgtgtcgctgtaccaccggttctgccagctcgac
cggaatgggggcggattcgtctccgccgaggaattcatgaccgtccccgagttcgccgtg
aaccctctctctcagaggcttctgaggatgctcgatgggctgaactttaaggagttcgtg
gcgttcttatcggcgtttagtccccgcgcaagcctgcagcaaaaaattgaatttattttc
agggtttatgacactgactgcaatgggaaggtggcatttgatgatatcttgagcatcttg
cgggatctgtctggttcttttatgactgagcagcagaggcagaaagttttgatccatgtt
ttagaagaagctggctatacaaaagattcaaattttactctgccagactttatgaagatt
cttgacaattctgatgtgaagatggaggttgaagttcctattgactaa

DBGET integrated database retrieval system