KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0450100-01Help
Entry
Os08t0450100-01   CDS       T02163                                 

Gene name
Os08g0450100
Definition
Similar to Pectinesterase (EC 3.1.1.11) (Fragment).
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dosa00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dosa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:join(21978129..21979074,21980641..21981368)
AA seq 557 aa AA seqDB search
MASMCSRSIPQLILLLSLTVFLLANAHPMAPPSPPRKAAAPPTAAKGVTGISPVLVSTLR
ETLDAIKNVASIISSFPIGGILGGGDLRLSSAIADCLDLLDLSSDELSWSMSTTSSSSYQ
PTNAGAATSSHVGTGDARSDLRSWLGGALSNQDTCKEGLDDTGSVLGSLVGTALQTVTSL
LTDGLGQVAAGEASIAWSSSRRGLAEGGGAPHWLGARERRLLQMPLGPGGMPVDAVVAKD
GSGNYTTVSAAVDAAPTESASRYVIYVKKGVYKETVDIKKKKWNLMLVGDGMGVTVISGH
RNYVDGYTTFRSATVAVNGKGFMARDVTFENTAGPSKHQAVALRCDSDLSVFYRCGFEGY
QDTLYAHSLRQFYRDCRVSGTVDFVFGNAAAVFQNCTLAARLPLPDQKNSVTAQGRLDGN
MTTGFAFQFCNVTADDDLQRALAGGGNQSSAAAVTQTYLGRPWKQYSRVVFMQSYIGAVV
RPEGWLAWDGQFALDTLYYGEYMNTGPGAGVGGRVKWPGFHVMTSPAQAGNFTVAQFIEG
NMWLPPTGVKYTAGLTS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatgtgttcgaggtcgataccccagctcatcctcctcctctccctgaccgtc
ttcctcctcgccaatgcgcatcccatggccccgccatcgccgccgcggaaggcggccgcg
cctccgacggcggcgaagggggtgaccggcatttcgccggtgctcgtctccacgctgcgc
gagacgctggacgcgatcaagaacgtcgcgtccatcatctcgtcgttccccatcggcggc
atcctcggtggcggcgacctccgcctctcctccgccatcgccgactgcctcgacctgctc
gacctgtcctccgacgagctgtcctggtcgatgtccaccacgtcgtcgtcgtcctaccag
cccaccaacgccggcgccgccacgtcgtcccacgtcggcaccggtgacgctcgctccgac
ctccggtcgtggctgggcggcgcgctgagcaaccaggacacctgcaaggagggcctcgac
gacaccggctccgtgctcggctcgctcgtcggcaccgccctccagaccgtcacgtcgctc
ctcaccgacggcctcggccaggtggccgccggcgaggcctcgatcgcgtggtcgtcgtcc
cgccgcggcctcgccgagggcggcggcgccccgcactggctgggagcccgggaacgccgg
ctgctgcagatgccgttgggccccggtggcatgccggtggacgccgtggtcgccaaggac
gggagcggcaactacacgacggtgagcgcggccgtggacgcggcgccgacggagagcgcg
agccggtacgtgatctacgtgaaaaagggcgtgtacaaggagacggtggacatcaagaag
aagaagtggaacctgatgctggtcggcgacggcatgggcgtgaccgtcatctccggccac
cggaactacgtcgacggctacaccaccttccgcagcgccacagtcgctgtgaacgggaag
gggttcatggcgcgggacgtgacgttcgagaacacggcggggccgtcgaagcaccaggcg
gtggcgctccggtgcgactccgacctctccgtcttctaccgctgcgggttcgagggctac
caggacacgctgtacgcgcactcgctccgccagttctaccgcgactgccgcgtctccggc
accgtcgacttcgtcttcggcaacgccgccgccgtgttccagaactgcaccctcgccgcg
cgcctcccgctccccgaccagaagaactccgtcaccgcgcagggccgcctcgacggcaac
atgaccaccggcttcgccttccagttctgcaacgtcaccgccgacgacgacctccagcgc
gcgctcgccggcggcggcaaccagagctccgccgcggcggtgacgcagacgtacctcggc
cggccgtggaagcagtactccagggtggtgttcatgcagtcgtacatcggcgccgtggtg
cgccccgaggggtggctggcgtgggacggacagttcgcgctcgacacgctctactacggc
gagtacatgaacaccgggcccggcgccggcgtcggcggcagggtcaagtggccggggttc
cacgtcatgacgagccccgcccaggccggcaacttcaccgtcgctcagttcatcgagggc
aacatgtggctgccgccaaccggcgtcaagtacaccgccggcctcacgtcttga

DBGET integrated database retrieval system