KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0455600-01Help
Entry
Os08t0455600-01   CDS       T02163                                 

Gene name
Os08g0455600
Definition
Similar to Serine/threonine protein phosphatase PP1-alpha catalytic subunit (EC 3.1.3.16) (PP-1A). Splice isoform 1.
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dosa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:join(22334723..22334912,22334997..22335553,22335663..22335839)
AA seq 307 aa AA seqDB search
MMDGNAVDELIRRLLDGKKVKPSSSAKKVQLSEAEIRQLCVTGKDIFLSQPNLLELEAPI
NVCGDIHGQFSDLLRLFEFGGLPPTANYLFLGDYVDRGKQSIETICLLLAYKIKYPDNFF
LLRGNHECASINRIYGFYDECKRRFSVRLWKLFTDCFNCLPVAAVIDDKILCMHGGLSPD
LDSLDRIREIARPVDVPDQGLLCDLLWSDPDRESSGWGENDRGVSFTFGADKVTEFLNKH
DLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFNNAGALMNVDASLLCSFQILKPF
RGKSQAE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgggaacgcggtggacgagctgatacggcggctgctcgacgggaagaaggtc
aagccgtcgtcgtcggcgaagaaggtgcagctcagcgaggcggagatccggcagctctgc
gtcaccggcaaggacatcttcctctcccagcccaacctcctcgagctcgaggcccccatc
aacgtctgcggcgacatccacggccaattctccgacctgctccggctgttcgagttcggc
gggctgccgccgacggcgaactacctgttcctcggcgactacgtggaccgcgggaagcag
agcatcgagacgatctgcctcctgctggcatacaagatcaagtacccggacaacttcttc
ctgctgcgaggcaaccacgagtgcgcgtcgatcaaccgaatctacgggttctacgacgag
tgcaagcgccggttcagcgtccgcctctggaagctcttcaccgactgcttcaactgcctc
cccgtcgccgccgtcatcgacgacaagatcctctgcatgcacggcggcctctcgccggac
ctcgacagcctcgaccggatcagggagatcgcccgacccgtcgacgtccccgaccagggc
ctcctctgcgacctcctctggtccgaccccgaccgcgagagctccggctggggcgagaac
gaccgcggcgtctccttcaccttcggcgccgacaaggtcaccgagttcctcaacaagcac
gacctcgacctcatctgccgcgctcaccaggtggtggaggacggctacgagttcttcgcg
gacaggcagctggtgaccatattctcggcgccgaactactgcggcgagttcaacaacgcc
ggcgcgctgatgaacgtggacgccagcctgctctgctcgttccagatcctcaagccgttc
agaggcaagtcgcaggcggagtga

DBGET integrated database retrieval system