KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0455600-01Help
Entry
Os08t0455600-01   CDS       T02163                                 

Gene name
Os08g0455600
Definition
Similar to Serine/threonine protein phosphatase PP1-alpha catalytic subunit (EC 3.1.3.16) (PP-1A). Splice isoform 1.
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Os08t0455600-01 (Os08g0455600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Os08t0455600-01 (Os08g0455600)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Os08t0455600-01 (Os08g0455600)
Transcription machinery [BR:dosa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Os08t0455600-01 (Os08g0455600)
Messenger RNA biogenesis [BR:dosa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     Os08t0455600-01 (Os08g0455600)
Spliceosome [BR:dosa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Os08t0455600-01 (Os08g0455600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:join(22334723..22334912,22334997..22335553,22335663..22335839)
AA seq 307 aa AA seqDB search
MMDGNAVDELIRRLLDGKKVKPSSSAKKVQLSEAEIRQLCVTGKDIFLSQPNLLELEAPI
NVCGDIHGQFSDLLRLFEFGGLPPTANYLFLGDYVDRGKQSIETICLLLAYKIKYPDNFF
LLRGNHECASINRIYGFYDECKRRFSVRLWKLFTDCFNCLPVAAVIDDKILCMHGGLSPD
LDSLDRIREIARPVDVPDQGLLCDLLWSDPDRESSGWGENDRGVSFTFGADKVTEFLNKH
DLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFNNAGALMNVDASLLCSFQILKPF
RGKSQAE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgggaacgcggtggacgagctgatacggcggctgctcgacgggaagaaggtc
aagccgtcgtcgtcggcgaagaaggtgcagctcagcgaggcggagatccggcagctctgc
gtcaccggcaaggacatcttcctctcccagcccaacctcctcgagctcgaggcccccatc
aacgtctgcggcgacatccacggccaattctccgacctgctccggctgttcgagttcggc
gggctgccgccgacggcgaactacctgttcctcggcgactacgtggaccgcgggaagcag
agcatcgagacgatctgcctcctgctggcatacaagatcaagtacccggacaacttcttc
ctgctgcgaggcaaccacgagtgcgcgtcgatcaaccgaatctacgggttctacgacgag
tgcaagcgccggttcagcgtccgcctctggaagctcttcaccgactgcttcaactgcctc
cccgtcgccgccgtcatcgacgacaagatcctctgcatgcacggcggcctctcgccggac
ctcgacagcctcgaccggatcagggagatcgcccgacccgtcgacgtccccgaccagggc
ctcctctgcgacctcctctggtccgaccccgaccgcgagagctccggctggggcgagaac
gaccgcggcgtctccttcaccttcggcgccgacaaggtcaccgagttcctcaacaagcac
gacctcgacctcatctgccgcgctcaccaggtggtggaggacggctacgagttcttcgcg
gacaggcagctggtgaccatattctcggcgccgaactactgcggcgagttcaacaacgcc
ggcgcgctgatgaacgtggacgccagcctgctctgctcgttccagatcctcaagccgttc
agaggcaagtcgcaggcggagtga

DBGET integrated database retrieval system