KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0473900-01Help
Entry
Os08t0473900-01   CDS       T02163                                 

Gene name
Os08g0473900, AMY3D, ALPHA-AMYLASE_3D
Definition
Alpha-amylase isozyme 3D precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os08t0473900-01 (Os08g0473900)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Os08t0473900-01 (Os08g0473900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr08:join(23341329..23341538,23341663..23342601,23342690..23342971)
AA seq 476 aa AA seqDB search
MPPDVEVIRHEHIDHPSSTRDRSVVVSSNSLSNTVSAYTDMKNTSSLCLLLLVVLCSLTC
NSGQAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVAPQGYMPGR
LYDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPDDR
LDWGPGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDG
WRLDFAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWVNAV
GGPAMTFDFTTKGLLQAGVQGELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGSTQKLW
PFPSDKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNGINAGSKLRIVVA
DADAYVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEKGSLRVPAGRHL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccccccgacgtcgaggtcattcgccacgaacacatcgatcatccatcatctacaaga
gatcgatcagtagtggttagcagcaactcactatcgaacacggtttcagcttacacagat
atgaagaacaccagcagcttgtgtttgctgctcctcgtggtgctctgcagcttgacctgt
aactcgggtcaagcacaggtcctcttccagggtttcaactgggagtcgtggaagcagcag
ggtggctggtacaacatgttgaaaggccaagtcgacgacatcgccaaggccggggtcacc
cacgtctggctgccgccgccgtcgcactccgtggcgccgcaggggtacatgccggggcgt
ctctacgacctggacgcgtccaagtacggcacggcggcggagctcaagtcgctgatcgcg
gcgttccacgggaagggcgtccagtgcgtcgccgacgtcgtgatcaaccaccggtgcgcc
gagaagaaggacgcccgcggcgtgtactgcgtgttcgagggcgggacgcccgacgaccgc
ctcgactggggccccggcatgatctgcagcgacgacacgcagtactccgacggcacgggc
caccgcgacaccggcgaggggttcggcgcggcgcccgacatcgaccacctcaacccgcgc
gtccagcgggagctcaccgactggctcaactggctcaagtccgacgtcggcttcgacggc
tggcgcctcgacttcgccaagggatactccacggacatcgctaagatgtacgtcgagagc
tgcaagccgggcttcgtcgtcgccgagatatggaactcgctgagctacaacggcgacggc
aagccggcggccaaccaggaccagggccggcaggagctggtgaactgggtgaacgccgtc
ggcgggccggcgatgacgttcgacttcaccaccaagggcctcctgcaggcgggcgtccag
ggcgagctgtggcggctgcgcgacggcaacggcaaggccgccggcatgatcgggtggctg
ccagagaaggccgtcacgttcgtcgacaaccacgacaccggctcgacgcagaagctttgg
ccgttcccctccgacaaggtcatgcagggctacgcctacatcctcacccaccccggagtc
ccctgcatcttctacgaccacatgttcgactggaacctgaagcaggagataaccgcgctg
gcggcgatcagggagaggaacggcatcaacgccgggagcaagctccggatcgtcgtcgcc
gacgccgacgcatacgtcgccgtcgtcgacgagaaggtcatggtgaagatcgggacgagg
tacgacgtgggcaacgcggtgccgtcggatttccatcagacggtgcacggcaaggactac
agcgtctgggagaaggggtccctccgcgtcccggcggggcggcacctatag

DBGET integrated database retrieval system