KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0478500-01Help
Entry
Os08t0478500-01   CDS       T02163                                 

Gene name
Os08g0478500
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:complement(join(23600508..23600935,23598058..23598919,23597902..23597984,23597572..23597657,23597323..23597485,23596747..23596867,23596474..23596631,23595367..23595451,23594977..23595192,23594644..23594705,23593794..23594466))
AA seq 978 aa AA seqDB search
MAEAAGSSSSSSASAVVVAVVIAVVVVVWVVVRRKVRRAAARREEVLRLTRLAQEESEMA
EVECARAYYSELFPSVVHATEMVDEAAWGAPPAVVPAQAEAEAEMEARAQPQPQPPVGAK
GVCAVCFRPTTFRCKQCKAVKYCSFKCQIAHWRQGHKNECRPPSTDANHDDVAELSVAKE
RKIEQTSASEENIAETNTAATVKNLNDKTKDMPSEVLASVEVPDDDHSVSAVKLPQSSSQ
VASLGSRKTESNMKPTTPVENGSYTKDLDEALVCRFQPSPPKISGSGSLINKESLIDSKK
HQDCSQTSNSKKYADNNNAQAALPVAVEPKTSRTALHVEVGHSKTKAAGSDNIGVSKMVP
SVLTVDKVSPVPGGRSVTPNSSKRADNIAERNSKPSEKSISTANSLATSLKKIVRQQTAP
KVVRHYPSEPTHFPYELFIKLYEKVELQPFGLHNLGNSCYANAVLQCLMFTRPLTSYLLG
GLHSKNCSKKEWCFMCEFEKLVGEGRQGKIALSPTGILSHLPDIGSSFGPGKQEDAHEFL
RYAIDAMQSVCMKEARKSGTHRLHEETTLMQLIFGGYLRSKIRCTRCDATSEQHERILDL
TVEIDGDISSLEGALERFTSTEVLDGDNKYKCSRCKSHERAKKKLTISEAPNVLTIALKR
YQSGKFGKINKAIRFPETLNLQRYMSPKADDTSPVYSLYAVVVHHDIMNAAFSGHYVCYV
KDTHGKWYKTDDSQVKPVSLENVMSKCAYMLLYARCSPRAPSSVRPALMAQDPARVKKDK
ARVNSGRWHGGGPIHQGGQMYADHMTDDLPHTYDEFGHGPYSPAESPSPSESSSIFTSSD
TGSHSTDSSESTRNSTSEDMERLIFGDQVSYFDGSMFGHGENGRMTYSRSKSSLGTSSSG
QEVDQYRPDEHRLQGAREGWNQGDESSSLYTNQSKHQFSSKLTEQYRRRLDGTEHDPGEA
NSVLLRRSARERTAQTFY
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcggcgggttcgtcgtcgtcgtcgtcggcgtcggcggtggtggtggctgtg
gtgattgcggtggtggtggtggtgtgggttgtggtgcggcggaaggtgaggcgcgccgcg
gcgcggagggaggaggtgctgcggctcacgcggctggcgcaggaggagtcggagatggcg
gaggtggagtgcgcgcgcgcctactactcggagctgttcccgagcgtcgtgcacgcgacg
gagatggtggatgaggcggcgtggggggcgccgccggccgtggttccggctcaggcggag
gcagaggcggagatggaggcccgggcccagccgcagccgcagccgccggtgggtgccaag
ggggtctgcgcggtgtgcttccggccgacgacgttcaggtgcaagcagtgcaaggctgtc
aagtactgttccttcaaatgccagatagcccactggagacagggtcataaaaatgaatgc
cgcccaccaagcactgatgctaatcatgatgatgtggctgaactttctgttgcaaaggaa
aggaaaattgagcagacaagtgcttctgaagaaaacatagctgaaaccaacacggcagcc
accgtgaagaatttaaatgataaaacaaaagatatgccctcagaagtacttgcttcggtg
gaggttcctgatgatgaccattctgtcagtgcggtcaaactccctcaaagttcttcacaa
gtagcttctcttggcagtagaaagacagaatcaaatatgaaacctacaactcctgttgaa
aatggttcttacacaaaggacttagatgaggcgttggtgtgtagatttcaaccttctcca
ccaaagattagtggctctggaagtcttatcaacaaagagtccttaattgattccaagaag
caccaggattgctctcaaactagtaacagcaaaaaatatgcagataacaacaatgctcaa
gctgctctacctgttgcagtagaacctaaaacttccaggactgctcttcatgtggaagtt
ggacactccaagacaaaagctgctggctcagacaacattggtgtgtcaaaaatggtgcca
tctgttttgactgttgataaagtttctcctgttcccggtggacgttctgttacacctaat
tcatcaaaaagggctgataatattgctgaaaggaattctaaaccatcagagaaatcaatt
tcaacagcaaatagcctggcaacatctctgaaaaaaattgtcaggcagcaaacagcacca
aaagttgtgaggcattatccatcagagccaacacattttccatatgagcttttcattaag
ctctatgaaaaggttgaattgcaaccgtttggtcttcataaccttggcaatagttgctat
gcaaatgctgttcttcagtgcttaatgtttacccgaccacttacatcatatcttttggga
gggcttcattcaaaaaattgttccaaaaaggaatggtgcttcatgtgtgaatttgaaaaa
ctcgttggggagggcagacaaggcaagattgctttgtcaccaactgggatactctctcat
ttgcctgacattggaagtagctttggtcctggtaaacaagaagatgctcatgaattcctt
aggtacgccattgatgctatgcaatctgtatgcatgaaggaagccaggaaaagcggcact
catcggttacacgaagaaacaacacttatgcaattaatatttgggggctatctgcgatct
aagataagatgcacaagatgtgatgctacttccgagcaacatgagcgtattttggatctt
actgttgaaatagatggcgacatcagttcactggaaggagcacttgagcgatttacatct
acagaagtcttggatggagataataaatataaatgcagcagatgcaaatcgcatgagcgc
gctaaaaagaagctgacaatatcggaagcaccaaatgtcctgactattgcgctgaaaaga
tatcagtctggaaagtttggaaagatcaacaaagccatcagatttccagagaccttgaac
ttgcagcgctatatgagcccaaaagctgatgacacttcccctgtttacagcctgtatgca
gtggttgtccatcatgatattatgaatgccgccttttctggtcattatgtatgctatgtg
aaggacacgcatgggaagtggtacaaaacagatgacagtcaggtcaaacctgtatctctg
gaaaatgtcatgtcgaagtgcgcatacatgctgctctatgcaaggtgttcaccaagagct
ccaagctctgtaaggccagcgctgatggctcaagatccagcacgtgtaaagaaggacaag
gcaagggtaaattcaggacggtggcatggaggaggtcccatacaccaaggtggtcagatg
tacgcagatcacatgacagatgatttgccccatacatatgacgagtttggacatggacca
tattcgccagcagaatctcctagtccaagtgagagttcatcaattttcaccagttccgac
acagggtcacatagcaccgacagcagtgaaagcactagaaactctaccagtgaggatatg
gaacgcctcatatttggtgatcaagtttcatactttgatggctctatgttcggacatggg
gaaaacggccgtatgacttattcccgatcaaagtctagcttgggtaccagttcatcgggt
caagaggtggatcagtataggcctgacgagcacaggcttcagggtgccagggagggttgg
aatcagggcgatgaaagttcttccttgtatactaaccaaagtaaacatcaatttagtagt
aagttaacagaacaatataggaggaggttagatgggactgagcatgatcctggagaagcc
aatagtgttttattgaggagatcggctagggaaaggacggcccaaacattttattga

DBGET integrated database retrieval system