KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0527100-01Help
Entry
Os08t0527100-01   CDS       T02163                                 

Gene name
Os08g0527100
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Os08t0527100-01 (Os08g0527100)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os08t0527100-01 (Os08g0527100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:complement(join(26236263..26237928,26234735..26235716,26234026..26234257))
AA seq 959 aa AA seqDB search
MDEEKASKGRPLNAPCLDLDLNLDLFAAAVPDPGCGDTASPEASKPEEKASKGRPLKAPR
LDLDLNLLAPAVPDPGCGDLALPGASKPGEKAAATTSNTDEELCAHFVRFEEDMVQFISK
LRSSKFAARCEHYLCENKVEKSSILVCIDCSLPFCIGDGTMDKPQGHARWHADLEQHCVA
ALFSKPDTLYCFICERCLNMEVDDTESESDRTECRHLLDEEDVTLIVSEVTTSKNIPACQ
HPGCKINGRTRIMVCTGCNKHFCTRAEAKKKPHGHARLHARKFEHHWVGLWYSDPYKGYC
FKCEFDLTLSAPTVEQGMVFGKELFGQESGLVKGHGCVIRGMPNLGNTCYINALLQCLFV
LGKLRARMLAPDAPSYILGYELKELFQEVNNVDNAQLQLNPTKFFACIRVLDARFISSDM
QDSHELLCFLLNELDKEEKSMVPPVSPTVVDSIFRVQLSATISCSHCSYNSVSHEVMYEL
SVPLPSERPPPKSIASPPRDISCMSREKTGIKLFPEVDTSNTEIVKAIAEGSVSHIASLE
LGDVDKEKTSEPLDGDSVEVEQRSPSKADDLGQNDNAGFENTSGEPQVSIEAKKNACSVE
GASEDKGKAQFSNMAYGKAKDNDSLASIEECLALFFKEELLEWRCDNCSGVSHHLSTTGS
KDGEQIMASTNENTIIDRDQTVQLDKVARQSEQSKNLESLALECTSSKQPHGSDSERKAM
LAMDSITEGINTLPPVKHTYSLRSRGRPPSHNKITSGMIHGEQDLASDNIANKKTDCHER
VQEAVSSCLPAEEPDDLLSGQENTSSLDQGKWKQVKVDHSADQVDAKQKERENRNQGGIQ
TRVINKLPPVLAIHLKRSKETGKVRGHVNFEEILDVGQFMDPSSEDKDNSSYHLVGVIEH
IGPSTSSGHMVAYVRPNQEQPDGGTSPWYRASDTDIRQVSLEEVLKCEASLFFYERIGG
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggagaaggcgagcaaggggaggccgctcaatgccccctgcctggatttggac
ctgaacctggatctgtttgctgcggccgtgcccgatcccggatgcggcgacacggcttcg
ccggaggcgagcaagccggaagagaaggcgagcaaggggaggccgctcaaagccccccgc
ctggacctggacctgaacctgcttgctccggccgtacccgatcccggatgcggcgacctg
gctttgccgggggcgagcaagccgggagagaaggcggcggcgacgaccagcaacaccgat
gaggagttatgtgcccacttcgtacgttttgaggaagacatggtacagttcatatcaaag
ctcaggtcctccaagttcgccgcgaggtgtgagcattacctgtgtgagaacaaggtggaa
aagagcagtatcttggtgtgcatcgattgcagcttgcctttctgcattggggacgggacc
atggacaagccgcagggacacgcccggtggcacgccgatctggagcagcattgtgtcgct
gcattgttcagtaaaccggacactctgtactgcttcatttgtgaacgttgtctgaatatg
gaggtcgatgacacggaatcagaaagcgacagaacggaatgcagacacttattggacgag
gaagacgttactctgattgtgtcagaggtcaccacctccaagaacattccggcgtgccaa
catcccgggtgtaagatcaatgggaggacccgtatcatggtgtgcacgggatgcaacaag
catttctgcactagagctgaggccaagaaaaaaccgcatggacatgcccggctgcatgcg
cggaagtttgaacaccattgggttggtttgtggtacagtgatccatataaggggtactgc
ttcaaatgtgaatttgacttgaccctcagtgcaccgactgttgagcaggggatggtgttt
ggcaaggaattatttggtcaagaatctggattagtgaaggggcatggctgtgttatcaga
gggatgccgaatcttggaaacacttgctacatcaatgcgttgttgcagtgcctatttgtg
cttggcaagctgcgggcaaggatgttagcaccagatgctccttcgtatatccttggttat
gaactgaaagagctctttcaggaggtaaacaacgttgataacgcacaactccaactgaac
cccacgaagttctttgcttgtattcgtgttttggatgcacggttcataagcagtgatatg
caagatagccatgaattgctttgctttttactcaatgaattggataaggaggagaagtca
atggtgcctccagtatctcctacagttgttgattccatttttcgtgttcaactgtctgct
accatttcctgcagccattgctcatataattcagtttcccatgaagtaatgtatgagctc
tcagttccactgccatcagagaggcctccgccaaaaagtattgcatcgccaccaagggac
ataagttgcatgtctcgagagaagactggtatcaaactattcccagaggttgacacgagt
aacaccgaaattgtcaaagcaattgctgaaggcagtgtttctcatatcgctagtttagaa
ctgggagatgtggacaaagagaaaacatctgagcctttggatggtgattctgttgaagtg
gaacagcgctcgccaagtaaggctgatgatttagggcaaaatgacaatgctggttttgag
aatacgtccggtgagccccaagttagtatagaagccaagaaaaatgcttgctctgtagaa
ggtgcttcagaagacaaggggaaagctcagtttagcaatatggcttatggcaaggcaaag
gataacgactctcttgcatcgattgaagagtgcctagcactattttttaaagaagagctg
ctggaatggagatgtgataactgttctggagtttctcaccatctgagcaccactggtagt
aaagatggtgaacagataatggcaagcaccaacgaaaacacaataattgacagagatcag
actgtgcagttggacaaggtagcacgccagagcgagcaatctaaaaatttggaaagtttg
gcactagaatgcacttcaagtaagcaaccacatggttctgattcagaacgtaaagctatg
ctcgcaatggacagcattactgaaggaatcaacacactacctcctgtcaagcacacatac
tcattgcgcagccgaggtcgaccaccaagccataacaaaatcacttctgggatgatccat
ggtgaacaagacttggcctctgataacatagccaacaaaaaaactgattgccatgaacgt
gttcaagaagctgtatctagttgccttccagctgaggaaccggacgacctgttgagtggc
caggaaaataccagcagtctagatcagggtaagtggaaacaagtaaaggtggatcatagt
gcagaccaagtggatgcaaaacaaaaagagcgggaaaataggaatcaaggtgggattcaa
actcgtgttattaacaagctgccacctgtattggccattcatctgaagagatccaaggag
actggtaaagttagaggacacgtgaactttgaggagatccttgatgtaggacagttcatg
gaccccagttctgaggacaaagacaattccagctatcacctagtcggtgtcattgaacac
attggccccagcaccagttcagggcacatggttgcttacgtgagaccaaatcaagagcag
cctgacggtggcacttccccttggtatcgtgcaagtgataccgacatcagacaagtatct
ctagaagaagttctcaagtgcgaggcctctcttttcttctatgagagaattggaggctaa

DBGET integrated database retrieval system