KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0527400-01Help
Entry
Os08t0527400-01   CDS       T02163                                 

Gene name
Os08g0527400
Definition
Similar to Ubiquitin carboxyl-terminal hydrolase.
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr08:complement(join(26256708..26256762,26255137..26256434))
AA seq 450 aa AA seqDB search
MTRRRSRPRRFGAIPAYSGAMEEEKRARAAERDRAIVRSPRKGKAPRIEPLDADDSGWGG
DASLEVYREAAAVATRGGAGGGGERCEHMTCSEHDVAEIVSKIASWGDPVCQDETCMCTE
RHLMMVCVECDMHFCIGRFAKKSKPRGHIEEHAFDDGHPVALWYEDPYTGYCFECEDPLT
IGGEEGDKGMKVKGEEGCRASGSDSGHGCVIGASGSGSGHGCAIRGIPNFGNTCYLNAVL
QCLLVLGKLRARMSGPDAPPPSGMLGIILHDLFVATESVSYTRDLLDPVMLLGCVRHYKS
EFQGNTMQDSHELLCCLRDSLIEEESKTRPDNMQQDAPSAVVPTVIDSIFRGQLFVTTLC
KYCSFESVSQGSQDAFYDLCVALPLQNERCISQQKIAIEQFPTIDKTNTEKIHAISGGSD
PQVPASELGDMVMVKTSEPLVVGKFMCSCT
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtcgccgatcgcgccctcgccgattcggagccatccccgcgtattccggcgcg
atggaagaggagaagagggcaagggcggcggaaagggatagggctatcgtcaggagcccg
cggaaagggaaagccccgcggatcgagccgctggatgcggatgattctggatggggcggc
gatgcctcgctggaggtgtacagggaggccgcggcggtggcaaccagaggcggcgccggc
ggcggcggcgagcggtgcgagcacatgacctgcagcgagcatgacgttgcggaaatcgtg
tccaagattgcgtcctggggcgacccggtgtgccaggatgaaacctgtatgtgcaccgag
aggcacctcatgatggtgtgcgtggaatgcgatatgcatttctgcattggaaggtttgcc
aagaagtctaagccgcgaggacacatcgaggagcatgcgttcgacgatgggcatccggtt
gcgctgtggtacgaagatccgtatactggttactgctttgagtgtgaggatcccttgacc
attggtggtgaggagggtgataagggaatgaaggtcaaaggcgaggaaggctgtcgcgca
tctgggtctgatagtgggcatggctgtgtcatcggcgcatctgggtctggtagtgggcat
ggctgtgccatcagagggataccgaattttggaaacacttgctacttgaatgcggtgttg
cagtgcctccttgtgcttggaaagctgcgggcaaggatgtctggaccggacgctccgcct
ccatcggggatgcttggtataatactgcatgatctctttgttgctacagaaagtgtgagc
tatacacgagacctgctggacccagtgatgctcttgggttgtgtgcgccactataaatca
gagttccaaggcaatactatgcaagacagccatgaattgctttgctgtttgcgtgatagt
ttgattgaggaggaaagtaaaacgaggcctgataacatgcaacaggatgctcctagtgct
gtggttcctacagttattgattccatatttcgtggtcagctgtttgttaccactctgtgc
aaatattgctcatttgagtcagtttcacagggttcacaggatgcattctatgatctctgt
gtggcattaccactacagaatgaaagatgcatatctcaacagaagattgccatcgaacaa
tttccaacaattgacaagactaacaccgaaaagattcatgcaatttctggaggcagtgat
cctcaggttcccgcttcagaattgggagatatggtcatggtgaaaacatcagagcctttg
gtagttggtaagtttatgtgttcctgtacctaa

DBGET integrated database retrieval system