KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0528000-00Help
Entry
Os08t0528000-00   CDS       T02163                                 

Gene name
Os08g0528000
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:complement(join(26289960..26291466,26288800..26289424,26287796..26288027))
AA seq 787 aa AA seqDB search
MDEKARAGKSPRLKRRSSGSDPLEEAAGLTSDSSSIRRCRHVSCDQATIDLGIALIKASI
DGPACDSFKCGTTEERGILVCLDCGSSLCALHARWHARMNRHWVALMHKRPNVAYCFSCE
DAYFISRVRFGGTADEDFFPISTPKKDEKGNKVDNEAGCHASAATGAGSGGGTMAVLTSN
VSPQRCCHVYKKGDVARVIKRIMLSDIAAACSDSMCDTTGRSLILVCLGCENPFCSGHAD
VHAKSTKHWNYLIYQSPYIVCCFVCKGIVFLGGQDKEEMPVDNATAGDASGSVIEHAHAI
RGITNLGNTCYLNSLVQCLLALGRLRARMLRPEDTTGRLGTVLRYLFQDTDSVNNSGGLL
NPSGLLRRVRMFVPESQVTSMHDSHEALCRLRTNLDEEERLMKYGALSVEAPTVIDSIFG
GQLSVTKTCKCCSLSSVSHGIVFHDLSMPITPKKPLAKRVEPLWITKGRRSQRKRNTEKT
HTIAEDGDSQNVMVKTSEPLGVDSTKVEQISQSKDAVQGPLQIQKDKVQGKAVDFLPQNV
LSDAKVEGMDATRADSHIPEYLAPAPTFSPLREDDAQVALGIDVEKNGSAVRPEVSTEAK
VTTSSAKVTAKDKGKTRSSNIICNKAQDINSLASIEECLELHFEAETVELTCENCSKFAQ
KLNKSVIQTRLSLLPPVLVIHLKRSLLQSDKVKGHVSFKEILDVGLFMDPSSVDKDNSIY
RLASVIEHHGHGKDSGHFVAYVRQSRPQQTNGSSSWFWASDTDIREVPLEEVLKCEAYLL
FYERMEG
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaaagcgagggccggcaaatccccacgcctgaagcggcgctcttctggaagc
gatccgttggaggaagcggcggggttaaccagcgacagtagtagtattcggcggtgccgg
cacgtctcgtgtgaccaggctaccattgatctgggcatagcactgatcaaggcctccatt
gatggcccagcgtgtgattctttcaagtgtggcaccactgaggagaggggaatcttggtt
tgcttggattgcggttcgagtctctgcgctctacacgcgagatggcacgcccggatgaac
cggcattgggttgctttgatgcacaagagacccaatgtggcgtattgcttctcatgcgaa
gacgcctatttcatcagccgtgtgaggtttggggggacggccgatgaggatttcttccca
atcagtacccctaagaaggatgagaagggaaataaggttgacaatgaggcaggttgtcat
gcatctgcggcgacaggggctggttctggaggcggcacaatggcggtgttaaccagcaat
gtcagtccccagcggtgctgtcatgtgtataagaagggtgatgttgctcgggtcataaaa
aggatcatgttaagcgatatcgccgcggcgtgtagtgattccatgtgtgataccactggg
aggagcctgatcttggtgtgcttgggatgtgaaaacccgttctgcagtggacatgccgat
gtgcatgccaagagcaccaagcactggaattatttgatttaccaaagcccatatatagtg
tgctgctttgtgtgtaaaggcatcgttttcctcggtggtcaggataaggaggagatgcca
gttgacaatgcaacagctggtgatgcatctgggtcagttattgagcatgcccatgctatc
agagggataacaaatcttggaaacacttgttacttgaattcattggtacagtgcctcctt
gcacttggaaggctgcgggcaaggatgttaagacctgaagatacaacggggaggcttggt
acagtactgagatatctctttcaggatacggacagtgtgaataactcaggaggcctgctg
aatccaagtggcctcttgcgtagagtacggatgtttgtcccagagtctcaagtcacttct
atgcatgacagccatgaagcgctttgccgtttgcgcactaatttggatgaagaggaaagg
ttgatgaagtatggtgctctcagtgtagaggctcctaccgtcattgattccatttttggc
ggtcagctgtctgttaccaagacatgcaaatgctgctcacttagttcagtttcacatggt
atagtattccatgatctctcaatgccaataacaccgaagaaacctctagccaaacgtgtt
gaaccactatggatcactaaaggtcgcagatctcaacggaagaggaacacagaaaagact
catacaattgctgaagacggtgattctcagaatgtcatggtgaaaacatcagaacctttg
ggagttgattctactaaagtggaacagatctcacaaagcaaggatgctgtacaaggccct
ttgcagattcagaaggataaggtccaaggaaaggctgttgatttccttcctcaaaacgtg
ttgtcggatgccaaagttgagggaatggatgcaacacgagcagattcccacattccagaa
tatcttgctccagctccaaccttttctccactaagggaagatgatgcacaggtagcatta
ggtattgatgtggagaaaaatggcagtgctgttcggccagaagttagtactgaggccaag
gtgaccacttcctcagcaaaagttactgcaaaagacaaggggaaaactcggagtagcaat
attatttgtaacaaggcacaggatataaactctcttgcgtcgattgaggagtgcttggaa
ctgcattttgaagcagagacggtagaactgacctgtgagaactgctccaagtttgctcag
aagctgaataaaagtgtaattcaaacacgtcttagcctgctgccacctgtactagtcatt
catctgaaaagatcattgttgcagtctgataaggtgaaaggacatgtgagctttaaggaa
atccttgatgtgggactgttcatggaccccagctcagtggacaaagataattcaatttat
cgtctagctagtgttattgagcaccatggccacggcaaagattcagggcactttgttgct
tatgtgagacaaagtcgtccgcagcagaccaatggctcttcctcatggttttgggcaagt
gacaccgacatcagagaagtccctttagaagaagttctcaagtgcgaggcttaccttctt
ttctatgagaggatggaaggctga

DBGET integrated database retrieval system