KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0528100-00Help
Entry
Os08t0528100-00   CDS       T02163                                 

Gene name
Os08g0528100
Definition
Similar to Ubiquitin carboxyl-terminal hydrolase.
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os08t0528100-00 (Os08g0528100)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os08t0528100-00 (Os08g0528100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr08:complement(join(26297885..26297999,26296195..26297763,26295253..26295600,26294725..26295226,26293690..26293921))
AA seq 921 aa AA seqDB search
MNEEKRARVGDTAETPRKSPRLDRPAAAAAAAAPLTSNGVMGEKKKKNATRDVSDWCWWG
KAAALLSGGDRRTRRCRHVLCEQADIDVAITLIKTRVDTPVCCVNKCDDTEGREISVCLD
CQLSFCTAHGKPHVFMNDHWIALVYKRPNVAHCFACEECYFIRTDSLGEGMAVGENGFSI
GTHKKDEKGMTTVNNEAGVHASMVSDYESALMVALLSDVGTPRCRHDMYNKDEVDLVQRR
IMFCDITRMCSDCDNISVLMIFVCLGCEKPFCTVHSSLHAESTKHLVGLVYHNPYVACCF
LCSETFVLIGEGDKRMPVDKAAGGYASESVIGHAHAIKGIPNLGNTCYLNSLMQCLLVLG
KLRARMLGPDAPSGTLGTALHDLFEQTYSVNNATGLLETSLLLDCVCNLDPQFVGGFMHD
NHELLCCLRKNLDEEERMRTPPNMQDSSAGAVPPTVFNSIFGGQLFVTRSCKCCSFCSVS
HAVFYDLSVPVPPKKPPAKSVESTPWIEGHRSQPKICINQFEAIHKRNTEKTHRIVEDAD
SDPASELKDMVMVKTSEPLEVDYTEVEQISQSKDYVQDPQNVLADVKTAGMDATTTDTRI
PEYIGPHPPVSQLREENAQLESCNDVGKDGNAILEVSSEHKIDTFSAEVTTEDKGKTCSS
DVVCGKAQDIDSLPSITKMIEWTCENCSKGARKSDVTEGTYSEQMLSSTNEDTAVGGYQR
EQSEKITCQSEQSNKKPECPEGVQDAVPHCVPAERQDNLLSSQDQNATTLDEGRGKQKLH
HSAHQVEECQNEQKDRNKGATQTRISKLPLVLTIHLMRSLLGPDKVMGHVSFKEILDMGL
FMDPSSEDKDNSIYRLAGVIEHHGRGKDSGHFVAYVRPSPRQQTNGSSSWFCASDTDIRE
VSLEEVLKCEAYLLFYERMEG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggagaagagggcgagggtgggggatactgccgagaccccgcggaaatcccct
cgcctggatcggccagctgcggcggcggcggcggcggcgccgttaaccagcaacggcgtg
atgggcgagaagaagaagaagaatgcgacgcgggatgtgagcgattggtgttggtggggg
aaagcggcggcattactatccggcggcgaccgccgtactcgacggtgccgccatgtcttg
tgtgagcaggctgacattgatgtggccataacactgatcaagacccgcgttgacaccccg
gtgtgttgtgttaacaagtgtgatgatactgaggggagggaaatctcggtgtgtttggat
tgccagttgagtttctgcacggcacacgggaagccgcacgtctttatgaacgaccattgg
attgctctggtgtacaagaggcccaatgtggcgcattgcttcgcgtgtgaagagtgctat
ttcatcagaaccgacagtctcggggagggaatggcggtcggtgagaatggcttctccatc
ggtacccataagaaggatgagaagggaatgacgacggtcaacaatgaggcaggtgttcat
gcatctatggtgtctgattatgaaagcgccctcatggtggctttactcagtgatgtcggt
actccacggtgcaggcatgacatgtataacaaggatgaggttgatttggtccaaagacgg
atcatgttctgcgatatcaccagaatgtgtagtgattgtgacaacatcagtgtgcttatg
atctttgtgtgcttgggatgtgaaaagcctttctgcactgtacactccagtttacatgct
gagagcaccaagcatttggttggtctggtgtaccataacccgtatgtggcgtgctgcttc
ctgtgtagtgaaacctttgtcctcattggtgagggggataagaggatgccagttgacaaa
gcggcaggtggttatgcatctgagtcagttattgggcatgcccatgctatcaaagggata
ccgaatcttggaaacacttgctacttgaattcattgatgcagtgcctccttgtgcttgga
aaactgcgggcaaggatgttaggaccggacgctccatcagggacccttggtactgcattg
catgacctctttgagcaaacatacagtgtgaataatgcaacaggcctgctggagacgtca
ttgctcttggattgtgtatgcaatttggacccacagttcgtaggaggttttatgcatgat
aaccatgaattgctttgctgtttacgtaaaaatttggatgaggaggagaggatgaggacg
cctcctaacatgcaagacagttctgctggtgcagtgcctcctacggtttttaattccatt
ttcggtggtcagctatttgttaccagatcgtgcaaatgttgctcgttttgttcagtttcc
cacgctgtattctatgatctctcagtaccagtaccaccgaagaagcctccagccaaaagt
gttgaatcaacaccatggattgaaggtcacagatctcaaccgaagatttgtatcaaccag
tttgaagcaatacataagaggaacacagaaaagactcatagaattgttgaagatgccgat
tctgatcctgcttcagaattgaaagatatggtcatggtgaaaacatcagagccattggaa
gttgattatactgaagtggaacagatctcacaaagcaaggactatgtacaagatcctcaa
aatgtgttggctgatgtcaaaactgcaggaatggatgcgacaacaacagatacccgcatt
ccagaatatatagggccacatccacctgtctctcaattaagggaagagaatgcacagtta
gaatcatgcaatgatgtggggaaagatggcaatgctattctcgaagttagttcagaacac
aagatagacactttctcagcagaagttactacagaagacaaggggaaaacttgcagtagt
gacgttgtttgtggaaaggcacaggatatcgactctcttccatcgattacgaagatgata
gaatggacctgtgagaactgctccaaaggtgctcggaagtcagatgtcactgaaggtaca
tacagtgaacagatgctgtcaagtactaatgaggacacagcagttggtggataccagagg
gaacagtcagagaagataacatgccaaagtgagcaatccaacaaaaaacctgaatgccct
gaaggtgttcaagacgctgtacctcattgtgtcccagctgagagacaggacaacctgttg
agcagtcaggatcaaaatgccaccacactagatgaaggaaggggtaagcaaaagcttcat
catagtgcacaccaagtcgaagaatgccaaaatgagcagaaagataggaataaaggtgct
actcaaacacggattagcaagttgccacttgtgttaaccattcatctgatgagatctttg
ttggggcctgataaggtgatgggacatgtgagctttaaggaaatccttgatatgggactg
ttcatggaccccagctctgaagacaaagataattccatttatcgtctagctggtgttatt
gagcaccatggccgcggcaaagattcagggcactttgttgcttatgtgagaccaagtcct
cggcagcagaccaatggttcttcctcatggttttgtgcaagtgataccgacatcagagaa
gtctctttagaagaagttctcaagtgcgaggcttaccttcttttctacgagaggatggaa
ggctga

DBGET integrated database retrieval system