KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0557000-01Help
Entry
Os08t0557000-01   CDS       T02163                                 

Gene name
Os08g0557000
Definition
Similar to Protein-L-isoaspartate O-methyltransferase.
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Os08t0557000-01 (Os08g0557000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr08:join(27877569..27877574,27878132..27878405,27878995..27879159,27879595..27879845)
AA seq 231 aa AA seqDB search
MEHRLWSSGASDKNKAMVEQLQRYGIIKSSKVAQVMETIDRGLFVPPGASPYFDSPMPIG
YNATISAPHMHASCLELLEKHLQPGMRALDVGSGTGYLTACFAIMVGPEGRAVGVEHIPE
LVTSSIENIKKSAAAPQLTDGSLSIHITDGREGWPELAPYDAIHVGAAAPQIPQALIEQL
KPGGRMVIPVGTMFQELKVVDKNQDGKVSIRDETAVRYVPLTSKDAQLQAN
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggagcaccgactgtggtcaagcggggctagcgacaagaacaaggcaatggttgagcag
ctccagaggtacgggattatcaagtcgagcaaggtcgcgcaggtgatggagaccatcgac
agggggctgtttgtgcctcctggtgcttctccctatttcgacagcccgatgcccatcggt
tacaacgccaccatttctgcgcctcacatgcacgcctcttgcttggagctcctggagaag
caccttcagcctggcatgcgtgctctggatgttggatcaggcacagggtacctaacagct
tgcttcgcgattatggttggaccagaagggcgagcagttggtgttgaacatatcccagag
ttggttacttcgtctattgaaaacatcaagaaaagtgcagcggctccacagttaactgat
ggatccctcagtatacatattaccgatggcagagaaggttggccagagctcgcaccctat
gatgccatccatgtcggagctgctgcaccgcagattccacaggcgttgattgagcagcta
aagcccggtggcagaatggtgatcccagttgggactatgttccaggagctgaaagtggtg
gacaagaaccaggatggcaaggtcagcataagagatgagacggctgtgcgctatgtgccc
ctcacaagcaaggatgcgcagctgcaggctaactga

DBGET integrated database retrieval system