KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0255300-00Help
Entry
Os09t0255300-00   CDS       T02163                                 

Gene name
Os09g0255300
Definition
(RAP-DB) Glycoside hydrolase, family 32 protein.
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00052  Galactose metabolism
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Os09t0255300-00 (Os09g0255300)
   00500 Starch and sucrose metabolism
    Os09t0255300-00 (Os09g0255300)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Os09t0255300-00 (Os09g0255300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4813 Fur_reg_FbpA
Motif
Other DBs
RAP-DB: Os09t0255300-00
Position
chr09:join(4190886..4191045,4191204..4191212,4197258..4198012,4198129..4198308,4198379..4198627)
AA seq 450 aa AA seqDB search
MARLGLAVCAVSFHLCLLLSSTSSLRLNPTTEDTANHGRRTAYHFQPAKNWQNDPNGPLY
HNGMYHLFYKYNPHSALWDIGNLSWGHFVSGDLLNWAALDTALDPTSPFDANGCWSGSAT
ILPGGLPAILYTGIDAGKEQVQNVAFAKNPSDPLLREWEKPAYNPVIALPPDVPGDNFRD
PSTAWLGRDGLWRIAVSAEVDGVASTLVYRSEDFVRWERNAAPLHASRAAGMVECPDMFP
VAENGEDGLDTSTNGAGGVRHVLKLSVMDTLQDYYMVGTYDDAADAFSPAEPERGDDCRR
WRRLDYGHTFPRKMWIAKDGKQLLQWPIEEIETLRRKRAAGLRRGTRLGAGAVQEIVGVA
SSQADVEVIDHSVVESFGGGGRACITARVYPEHVATSSSHLYVFNNGSDDVKVAKLEAWD
LATATVNVVVGDHHGLAAPALELEPTRTTQ
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcgagattaggtcttgccgtgtgcgccgtctccttccacctctgccttcttctgtcg
tcgacctcctcgctccggctaaaccccacgacggaggacacagccaaccatggcagaaga
actgcttatcacttccagcctgcaaagaactggcagaatgatccgaatgggcctttgtac
cataacggtatgtaccatttgttctacaagtacaacccgcatagcgcgctctgggacatc
ggcaacctctcctggggccactttgtctccggcgacctcctcaactgggccgctctcgac
accgcgctcgaccccacctcgccttttgacgccaatggctgctggtcgggctccgccacc
atcctccccggcggcctcccggccatcctctacaccggcattgacgccggcaaggagcag
gtgcagaacgtcgccttcgccaagaacccctccgatccgctcctccgtgagtgggagaag
cccgcgtacaatccggtcatcgcgctcccgcccgacgtccccggcgacaacttccgcgac
ccctcgacggcgtggctcgggcgcgatggcctgtggcggatcgccgtctccgccgaggtg
gacggcgtggcgtccacgctcgtctacaggagcgaggacttcgtccggtgggagcggaac
gccgcgccgctgcacgcgtcgcgcgccgccggcatggtggagtgcccggacatgttcccc
gtggcggagaacggcgaggatggcctcgacacgtcgacgaacggcgccggcggcgtgcgc
cacgtcctgaagctgagcgtgatggacacgctccaggactactacatggtcggcacgtac
gacgacgcggcggacgccttctcgccggcggagcccgagcgcggcgacgactgccggaga
tggcggcggctggactacggccacacgttcccgaggaagatgtggatcgccaaggacggc
aagcagctgctgcagtggccaatcgaggagatcgagacgctgaggaggaagcgcgccgcc
ggtctccggcgaggcaccaggctaggcgccggcgcggtgcaggagatcgtcggcgtggcg
agctcgcaggcggacgtggaggtgattgaccattcggtggtggagagcttcggcggcggc
gggcgggcgtgcatcacggcgcgggtttacccggagcacgtggcgacgagcagcagccat
ttgtacgtgttcaacaacgggagcgacgacgttaaggtggccaagctggaggcgtgggac
ctggcgacggcgaccgtcaacgttgttgttggagaccaccacggccttgctgcgccggcg
ttggagttggagccgacacgtacgacgcagtga

DBGET integrated database retrieval system