KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0307800-01Help
Entry
Os09t0307800-01   CDS       T02163                                 

Gene name
Os09g0307800
Definition
Whey acidic protein, 4-disulphide core, conserved site domain containing protein.
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Os09t0307800-01 (Os09g0307800)
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Os09t0307800-01 (Os09g0307800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:complement(join(8046738..8046761,8045878..8045995,8045248..8045347,8044802..8044901,8043568..8043646,8042291..8042462,8042125..8042205,8041805..8042008,8041343..8041394,8041194..8041259,8040131..8040157))
AA seq 340 aa AA seqDB search
MPRPAKIRKKHENVFDQLIKAIKAPVDFDLPPVLKEWKSNYYVPIKRNAYITRKRVEDDG
IFCSCTPSGSSATCDKDCQCGMLFSCCSSTCKCENKCANKPFQHRTLRKTKLIKTEKCGN
GVVAEEDIKKGEFVIEYVGEVIDDRTCEQRLWKMKRQGDTNFYLCEVSSNMVIDATNKGN
MSRFINHSCEPNTEMQKWTVEGETRVGIFALRDIKTGEELTYDYKFVQFGADQDCHCGSS
NCRKMLGITKPVNSIVLHNGNLSQDQHVRKKRKTYLENCIGEIVRLWHRRHSMYLAASIY
DFNERNGIHTLLFTDATIEEFDLREEDWDFLPDPDGPEEV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggccggcgaaaatcaggaaaaaacatgagaatgtgtttgatcaattgatcaag
gcgataaaagctcctgtggactttgatctgccgcctgtattgaaagaatggaagtcaaat
tactatgtgccaattaagcggaatgcttatattactcggaaacgcgttgaggatgatggc
attttttgttcctgtaccccttctggatcatccgcaacttgtgacaaagattgccaatgc
gggatgttgttctcttgttgttcgtcgacctgtaaatgtgagaataaatgtgctaacaaa
ccgttccagcataggactttgaggaaaaccaaattaattaagacagagaaatgtggcaat
ggggtggtagctgaggaagatattaaaaaaggagaatttgtaatcgaatatgttggagaa
gttattgatgacagaacatgtgagcagagactatggaaaatgaagaggcagggtgacact
aatttctatctttgtgaggtcagtagtaatatggtgatcgacgcgaccaacaaaggaaac
atgtcgcgcttcataaatcatagctgtgagccaaacacagagatgcagaaatggactgtt
gagggagagaccagagttggaatttttgctcttcgtgacataaaaacgggggaggagctg
acctatgattacaagtttgtccaatttggagctgatcaagattgtcactgtggatcttca
aactgtcgaaaaatgcttggcatcacaaagcctgttaactcaattgtacttcataatgga
aatctgtcacaagatcagcatgtccggaagaaaagaaagacatatttggagaattgtatt
ggggagattgtccgtttgtggcatcgacgtcacagcatgtatctcgcagcaagtatatat
gacttcaatgagcgcaatggaatacatacattattgtttaccgatgcaactattgaagaa
tttgatttgagagaggaagattgggacttcttaccggatccagatggtcctgaggaagtg
tga

DBGET integrated database retrieval system