KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0347800-01Help
Entry
Os09t0347800-01   CDS       T02163                                 

Gene name
Os09g0347800
Definition
Histone acetyltransferase type B, catalytic subunit domain containing protein.
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:join(10922478..10922553,10923340..10923381,10923705..10923814,10923894..10923962,10924843..10924881,10924964..10925037,10925132..10925198,10925614..10925690,10925764..10925926,10926020..10926703)
AA seq 466 aa AA seqDB search
MALKQKGTDAAADPKKRRRVGFSGIDAGVEANECMKVFIARNPDEAGSANSTSLQPFDLN
HFFGEDGKIYGYKNLKINVWISAISFHAYADISFEETSDGGKGITDLKPVLQNIFGENLV
EKDEFLKTFSKECEYLSNVVTDGNVIKHDASIDEDSAVEIVRVELQGAAAFLYCRLVPLI
LLLVEGSTPIDITEHGWEMLLVVKKSAQASSSSNFLVLGFAAVHHFYHYPESTRLRISQI
LVLPPYQGEGHGLRLLETINSISESENIYDVTIEDPSDYLQYIRSSIDCLRLLTFDPIKP
ALCSMVSSLKDTNLSKRTSSLKMVPPSDLAETVRQKLKINKKQFLRCWEILIYLNLDAED
RKSMDNFRACIYDRIKGEILGTSTGPNGKRLVQMPSNFDEETCFAVYWTQDGGDADDQTV
EQQPEDLKTQEQQLNEVVDSQMEEIVEIAKNVTSRGKDKLSVSCSV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaagcagaaggggaccgacgccgccgccgaccccaagaagcgccgccgcgtc
ggcttctccggcatcgatgctggcgttgaggctaacgagtgcatgaaagtgtttattgca
agaaaccctgacgaggcaggctcagcaaatagcacttctcttcaaccatttgacctaaat
catttttttggtgaagatggcaagatatatggctacaaaaatttgaagatcaatgtgtgg
atcagtgcaatatcatttcatgcatatgctgatatctcatttgaggaaacatctgatgga
ggaaaaggaatcacagatctcaagcctgttcttcagaatatttttggggaaaacttggta
gaaaaagatgaatttctgaagacattttcaaaggaatgtgaatatctcagcaatgtggtg
acagatggcaatgtcattaaacatgatgcttcaattgatgaagattcagcagttgagatt
gttcgagttgaactacaaggtgctgctgcttttctttattgtcgtctggtgccacttatt
ctgcttttggttgaaggttcgacgcctatagatataactgagcatggatgggaaatgctc
ctggtagtaaagaagtcagcacaggcgtcatccagctctaactttctagtgctagggttt
gcagctgttcatcatttttatcactaccctgagagcactcgcctgcggatcagccagata
ctggtcttgccaccttatcaaggtgaaggccatggacttcgtcttcttgagacgatcaat
tctatttctgagtctgagaacatatacgatgtgaccatagaagatccttccgattacctt
cagtacatacgttcatccattgactgtctccgccttctcaccttcgatccaatcaagcca
gcgctctgttccatggtctcatctctgaaggataccaacctttcgaaaaggaccagcagc
ttgaaaatggttccaccttccgaccttgctgagacggtccgacagaagctgaagatcaac
aagaagcagttcctccggtgctgggagattctgatctacctaaaccttgacgctgaggac
cgcaagagcatggacaacttcagggcctgcatctacgaccgcatcaaaggcgagatactt
ggcacttccactggccccaacgggaagcggctcgtccaaatgccgagcaatttcgacgag
gagacatgctttgctgtgtactggacacaggacggtggggatgcagatgaccaaactgtt
gagcagcagcctgaggatctcaagacccaggagcagcagctgaatgaggtggttgacagc
caaatggaagagatcgtcgagatagccaagaacgtcacctcacgcggcaaggataaactg
agcgtttcttgctccgtatga

DBGET integrated database retrieval system