KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0394100-01Help
Entry
Os09t0394100-01   CDS       T02163                                 

Gene name
Os09g0394100
Definition
Malonyl-CoA decarboxylase family protein.
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Os09t0394100-01 (Os09g0394100)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Os09t0394100-01 (Os09g0394100)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Os09t0394100-01 (Os09g0394100)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Os09t0394100-01 (Os09g0394100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr09:complement(join(13629204..13629739,13628949..13629093,13628773..13628863,13628464..13628522,13628310..13628387,13628113..13628196,13627762..13627940,13627339..13627461,13627185..13627257,13626794..13626879,13626603..13626693))
AA seq 514 aa AA seqDB search
MTRNHSPKSLAVLLRARMHPDPVSPAPPPPAPTAAAAPDPDPSAPPAAAAVRHWLHASVS
SSASTALDRFSDGYRSLDRPGRREILRSLAADYDVPRARVRDLMRQYLSAAAAGGEEEEE
EHPEAGGGGGSASAMYRMERGLREALRPKYAGFLEAMNAQPGGLKLLAVIRADLLALLGE
ENLPALRALDGYLKEKLVTWLSPAALTLHQITWDDPASLLEKIVAYEAVHPIRNLIDLKR
RLGVGRRCFGYFHPAIPGEPLIFIEVALLKDTAASIQEVLWDDPPTPESEARCALFYSIS
STQPGLSGINLGKFLLKRVIEMLRRDMPSVQIFATLSPIPGFMQWLLAKLASQIKLAEAE
SQDGSLLEGTSSTFRESILFPEEERMIHDAVEHAGGKSGIKLLQDILKSSQWVKSDKLSS
ALKSPLMRLCARYLAREKKRGKALDAVANFHLQNGAMIERINWMADQSEKGIQQSGGIMV
NYMYRLENIEEYALSYLGTGLAHTSSNLLQYIEV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaaccactcccccaagtccctcgccgtcctcctccgcgcccggatgcacccc
gaccccgtctcccccgccccgccgccgcccgctccgacggcggcggcggcacccgacccc
gatccgtccgccccgcccgccgccgccgccgtccgccactggctccacgcctccgtctcc
tcctccgcctccaccgccctcgaccgcttctccgacggctaccgctccctcgaccgcccc
ggccgccgcgagatcctccgctccctcgcggccgactacgacgtgccccgcgcgcgcgtc
cgcgacctcatgcggcagtatctgagcgccgcggcggcgggcggggaggaggaggaagag
gagcacccggaggcgggaggcggcggcggctctgcgtcggcgatgtaccggatggagcgg
gggctccgggaggcgctccggcccaagtacgccgggttcctcgaggccatgaacgcgcag
cccggcgggctcaagctcctcgccgtcatccgcgccgacctcctcgcattgctgggggag
gagaacttgccagcgctgcgtgcgctggacgggtacctgaaggagaagctcgtgacatgg
ctcagccccgcggcgctgaccctccaccagataacttgggatgatccggcctccttgcta
gagaagattgtggcatatgaagctgtgcatccaattaggaatttgattgacttgaagaga
aggttgggcgtcggtcgccgttgctttgggtacttccatcctgcaataccaggagaacca
ttgatcttcattgaagttgctctgctcaaagatactgccgcatctatacaggaagttctg
tgggatgaccctccaactcctgagagtgaagccagatgtgcattattttactcaatatca
tcaacccagccaggcctatctggtatcaatctgggaaaatttcttctcaaacgtgtgatt
gaaatgttaagaagagatatgccttcagtacagatttttgcaactcttagtccaatccct
ggtttcatgcaatggcttcttgctaagctggcatcccaaataaagttagcagaggcagaa
tcacaggatggcagtttattagaaggaaccagttccactttcagagaatccatccttttt
ccggaggaagagaggatgatacatgatgcggttgaacatgctggtggaaaaagtggaatc
aaactactgcaagatatactgaaatcaagtcagtgggtaaaatctgacaaattatcttct
gcactgaaatctcctttgatgcgtttgtgtgcaaggtatctcgccagggagaaaaaacga
ggaaaagctcttgatgctgttgcaaattttcacttgcaaaatggagcaatgatcgagagg
ataaactggatggctgaccaatcagagaagggcattcaacagagtggaggtatcatggta
aattatatgtacagattagagaatatagaagagtatgcgctgtcatatttgggtacaggg
ctcgctcatacttcatctaacttgctccaatatatcgaggtatga

DBGET integrated database retrieval system