KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0457400-01Help
Entry
Os09t0457400-01   CDS       T02163                                 

Gene name
Os09g0457400, ALPHA-AMYLASE_3A, AMY3A
Definition
Alpha-amylase isozyme 3A precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os09t0457400-01 (Os09g0457400)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Os09t0457400-01 (Os09g0457400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr09:join(17289136..17289234,17289361..17289491,17289901..17290708,17290799..17291083)
AA seq 440 aa AA seqDB search
MGKQMAALCGFLLVALLWLTPDVAHAQTQILFQGFNWDSWKKQGGWYNMLKDQVGDIASA
GVTHVWLPPPTHSVSPQGYMPGRLYDLNASKYGTKAELKSLIAAFHAKGIKCVADIVVNH
RCADDKDGRGVYCIFKGGGPRGCLDWGPSMICCDDTQYSDGTGHRDTGADFAAAPDIDHL
NPLVQRELSDWLRWLRRDVGFDGWRLDFAKGYSAAVARTYVQNARPSFVVAEIWNSLSYD
GDGKPAANQDGQRQELVNWVKQVGGPATAFDFTTKGILQSAVQGELWRMRDKDGKAPGMI
GWYPEKAVTFVDNHDTGSTQRMWPFPSDKVILGYAYILTHPGVPCIFYDHVFDWNLKQEI
NALAATRKRNGINAGSKLRVLAAESDMYVAMVDERVITKIGPRIDVGNIIPSDFHIVAHG
NDYCVWEKSGLRVPEPEGRR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcaaatggccgccctgtgtggctttctcctcgtggcgttgctctggctcacg
cccgacgtcgcgcacgcgcagacgcagatcctcttccagggttttaactgggactcgtgg
aagaagcagggtggttggtacaacatgctcaaggaccaggtgggcgacatcgccagcgcc
ggcgtcacgcacgtctggctcccacctcccacgcactccgtctcgcctcaaggctacatg
ccgggacggctctacgacctgaacgcgtccaagtacggcaccaaggcggagctcaagtcg
ctcatcgccgccttccacgccaagggcatcaagtgcgtcgcggacatcgtcgtcaaccac
cgctgcgccgacgacaaggacggccgcggcgtctactgcatcttcaagggcggcggcccg
cgcggctgcctggactggggcccctccatgatctgctgcgacgacacgcagtactccgac
ggcacgggccaccgcgacaccggcgccgacttcgccgcggcgcccgatatcgaccacctc
aacccgctcgtccagcgggagctctccgactggctcaggtggctcaggagggatgtcggc
ttcgacggctggcgcctcgacttcgccaagggctactcggcggccgtcgccaggacgtat
gtccagaacgccaggccgagcttcgtcgtggcggagatatggaactccctgagctacgac
ggcgacgggaagccggcggccaaccaggacggccagcggcaggagctcgtgaactgggtg
aagcaggttggcggcccggcgacggcgttcgacttcacgaccaagggcatcctgcagtcg
gcggtgcagggcgagctgtggcggatgcgggacaaggacggcaaggcgccgggcatgata
ggctggtatcccgagaaggccgtcaccttcgtcgacaaccacgacaccggctcgacgcag
cggatgtggccattcccgtctgacaaggtcattctgggctacgcctacatcctcacccac
ccaggagtaccatgcatcttctacgaccacgtgttcgactggaacctcaagcaagagatc
aacgcgctggcggcgacgaggaagcgcaacgggataaacgccgggagcaagctgcgcgtc
ctggcggcggagagcgacatgtacgtggcgatggtcgacgagagggtcatcaccaagatc
gggccgagaatagacgtgggcaacataatcccgtcggacttccacatcgtggctcatggc
aatgactactgcgtctgggagaagagcggccttagagtcccagaaccagaaggtcggcgc
tag

DBGET integrated database retrieval system