KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0457600-00Help
Entry
Os09t0457600-00   CDS       T02163                                 

Gene name
Os09g0457600, ALPHA-AMYLASE_3B, AMY3B
Definition
Alpha-amylase isozyme 3B precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os09t0457600-00 (Os09g0457600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Os09t0457600-00 (Os09g0457600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:join(17296197..17296289,17296366..17297304,17297404..17297688)
AA seq 438 aa AA seqDB search
MAKRIASMSSLLLIALLCLSSHLAQAQVLFQGFNWESWKKQGGWYNFLHGHVDDIAATGV
THVWLPPPSHSVAPQGYMPGRLYDLDASKYGTGAELRSLIAAFHSKGIKCVADIVINHRC
ADYKDSRGIYCIFEGGTPDSRLDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNT
RVQTELSDWLNWLKSDVGFDGWRLDFAKGYSAAVAKTYVDNTDPSFVVAEIWSNMRYDGN
GEPSWNQDGDRQELVNWAQAVGGPASAFDFTTKGELQAAVQGELWRMKDGNGKAPGMIGW
LPEKAVTFIDNHDTGSTQNSWPFPSDKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEIST
LAAVRSRNEIHPGSKLKILAAEGDVYVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNN
YCIWEKSGLRVPAGRHHY
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgcatagcctcaatgagcagcctcctccttatcgccttgctctgtctgagc
tctcacttggcccaagcccaggtcctcttccaggggttcaactgggagtcgtggaagaag
cagggcgggtggtacaacttcctccatggccacgtcgacgacatcgccgcgaccggtgtc
acgcacgtctggctcccaccgccgtcgcactccgtcgccccgcagggatacatgccgggc
cggctctacgacctggacgcttccaagtacggcacgggggcagagctcaggtcgctgatc
gccgccttccacagcaaaggcatcaagtgcgtcgccgacatcgtcatcaaccaccggtgc
gcggattacaaggatagccgtggcatctactgcattttcgagggtggcacgccggacagc
cgcctcgactggggccccgacatgatctgcagcgacgacacgcagtactccaacggccgc
ggtcaccgcgacaccggcgcagacttcggcgcggcgcccgacatcgaccacctcaacacg
cgtgtgcagacagagctgtccgactggctcaattggctcaagtccgacgtcggcttcgac
ggctggcgcctcgacttcgccaagggatactcggcggccgtcgccaagacgtacgtcgac
aacaccgacccgtccttcgtcgtcgccgagatatggagcaacatgcgttacgacggcaac
ggtgagccgtcgtggaaccaggacggtgaccggcaggagctggtgaactgggcgcaggcc
gtcggtggccctgcgtcagcgttcgacttcacgaccaagggcgagctgcaggcggcggtg
caaggtgagctgtggcggatgaaggacggcaacggcaaggcgccggggatgattggctgg
ctgccagagaaggccgtcaccttcatcgacaaccatgacactggctccacacagaactca
tggccgttcccctccgacaaggtcatgcagggctacgcctacatcctcacacaccctgga
gtaccctgcattttctacgaccatgtatttgactggaacctgaagcaggagatcagcaca
ttagctgcagtgagatcaagaaatgagattcatcccgggagcaagctgaaaatccttgct
gctgagggagacgtctatgtcgccatgatcgatgataaggtcataacaaagattgggaca
cggtatgacgtgggcaacttaatcccgtcagacttccatgtcgttgctcacggcaacaat
tactgcatttgggaaaagagcggtctcagagttcctgcagggcggcaccactattag

DBGET integrated database retrieval system