KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0464400-00Help
Entry
Os09t0464400-00   CDS       T02163                                 

Gene name
Os09g0464400
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 domain containing protein.
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Os09t0464400-00 (Os09g0464400)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os09t0464400-00 (Os09g0464400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:complement(join(17608101..17608513,17605621..17606287,17605451..17605539,17603624..17603748,17603416..17603578,17602861..17602945,17602555..17602712,17602157..17602241,17601774..17601986,17601372..17601433,17600530..17601256))
AA seq 928 aa AA seqDB search
MASAALSLAVAVVAVAVAAVVAVARGALRRAAARREEVRRLARLAAVEAEVAEREAYCYA
RGRGGVAGAPLWTVPEVASPREDEEEEEEEEAAAVELEMPAARQAEAAAAAAAVKGVCVV
CRRPTTFRCKRCKGVKYCTFKCQISHWRQGHKDECHPPRVDARPDNITVVSSVKKGVGMY
NSFEQSVKSSVEPAVEVNKSVAAVPELSEANLVSDGVDNERKKMRGQKASITAKVSEDVL
DNNRIRSVDSSRLPTSGKACNIQDATVNENFSKTSAGSSSSRVERSTTSEPELNHSNKQA
SGTDNLKSSRGLPSVSTVGTISSIHGSEKEAAMPNNRSLVKNIPRQQAAAKVVRHYPSEM
TLFPYEHFVKLYNFDKVELRPFGLVNLGNSCYANAVLQCLAFTRPLTAYLTEGLHSRNCN
LILSQNCVTYHGSKKEWCFMCEFEKLILEGRRGKSHLSPTGILSHLRDIGSSFGPGREED
AHEFLRYAIDTMQSASMKEAKKNGVYGLPEETTLIKCTMCQGSSEQCERILDLTVEIDGD
INTLEEALHRFTSTEILDGDNRYNCSRCKSYERAKKKLTISEAPNILTIALKRYQSGNFG
KINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYVCYVKDTQGKWH
KMDDSQVKPVSLEKVLSKCAYMLFYARCSPRAPNSVRKMILAQDSSCTKKAKQMVDPGPP
SLEGGSYLSRHQGGQSCRDHIVYDLTYTFGGSSYTVVESPSPSDSSSLFSNSDAGSTSTF
SSDSTDSTRNSTSMEEYDYIFGSSDQMYPVSTVVIPEEHELSYSRQRSSLNPSTSSQYVD
QAAEVEMLHQHQHQAGRGGWDEGDVMPFFYSNQGKHHDSSRSSNISSSNRKLTEQRRTIG
EVDHGPGEGHGSVLLRRAARERIAQAIY
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggcggcgttgtcgctcgcggtggcggtggtggccgtggcggtcgccgcggtg
gtggcggtggcgcgtggggcgctgcggcgcgccgcggcgcggagggaggaggtgcggcgc
ctcgccaggctcgcggcggtggaggccgaggtcgcggagcgcgaggcgtactgctacgcg
cgggggaggggcggcgtggcgggtgcgccgctgtggacggtgcccgaggtggcttcgccg
cgggaggacgaagaggaggaggaggaggaggaggccgcggcggtggagttggaaatgccg
gcggcccgtcaggcggaggcagcggcggcggcggcggcggtgaaaggggtgtgcgtggtg
tgccgaaggccaaccacgtttagatgcaagcgctgcaaaggggtcaaatactgtaccttc
aagtgccagatatctcactggagacaaggccataaagatgaatgccatccaccaagagtt
gatgccaggcctgacaatataacagtagtttctagtgttaaaaagggtgttggaatgtac
aattcatttgaacaaagtgtgaaatccagcgtagaaccagcggttgaagtcaacaagtca
gttgctgctgtgcctgaattgtctgaggcaaaccttgtctccgatggtgtagataatgaa
agaaagaagatgagaggtcagaaggcatctattactgcaaaggtttctgaggatgtcctt
gacaacaataggattagatctgttgatagttctaggctcccaacttctggtaaagcttgc
aatattcaggatgctactgttaatgagaatttctctaagacttcagcaggcagctccagt
tctcgagttgaacggtctaccacgtcggaacctgaactgaaccattctaacaaacaggct
tctggcacagacaaccttaaaagttcgagaggtttgccatctgtgtcaactgttggcaca
atttcttctattcatggatcagagaaagaagctgctatgccaaataatcggtcattggta
aagaatattcccaggcaacaagcagctgcaaaagttgtgaggcattatccatcggaaatg
acactttttccgtatgaacattttgtcaagctctacaattttgacaaggtggagctgcgc
ccttttggtcttgtgaaccttgggaatagttgttacgcaaatgctgttcttcagtgcttg
gcatttacgcggccacttacagcataccttacggaaggacttcattcaagaaattgtaac
ttaatactaagccagaattgtgttacataccatggttccaaaaaggaatggtgcttcatg
tgtgagtttgaaaaactcattctggagggtaggcgaggaaaatctcacttgtcacctact
ggaatactatctcatttgcgtgacattggaagtagctttggccccggtagagaagaagat
gctcatgaatttctcaggtatgcaattgatactatgcaatctgctagcatgaaggaagcc
aagaaaaacggtgtttatgggctgcctgaagaaacaacactgataaaatgcacaatgtgt
caaggcagttcagaacaatgtgaacgcattttggatcttactgttgaaatagatggggat
atcaatacccttgaagaagcacttcatcggtttacatctacagaaattttagatggtgat
aatagatacaattgcagcagatgcaagtcatatgaacgtgccaaaaagaagttgacaata
tcagaagcaccaaacatcctgactattgcgctgaaaagatatcagtctggtaattttggc
aagatcaacaaggctgtcaggttcacggagtacttgaatttgtctaactacatgagtaca
gcagatgatatttcccccgtgtaccagctctatgctgtggttgtccatcatgatgttatg
aatgcagccttttctggccattatgtgtgttatgtcaaagacacacaagggaagtggcac
aagatggatgacagccaggtgaaacctgtttctctggaaaaagtcttgtcaaagtgtgca
tacatgctattttacgcaaggtgttcaccacgggcaccaaactctgtaaggaaaatgatt
cttgctcaagactcatcgtgcacaaagaaagccaagcagatggtggatccaggaccacca
tctttggaaggaggaagttacttaagcagacaccaaggtgggcagtcatgtagagatcat
atagtctatgacctcacctacacattcggtggctcatcttatacagtagtggagtccccg
agtccaagtgacagctcctcgctgttcagcaactctgatgcagggtcaaccagcactttc
agtagtgatagcactgacagcacaaggaattcgaccagcatggaggagtatgattacata
tttggaagctcggatcaaatgtaccctgtaagcacggtggttatacctgaggaacatgaa
cttagctattcgcggcagaggtctagcttgaaccccagcacttcaagtcaatatgtggat
caagcagctgaggttgagatgctgcaccagcaccagcatcaggccggcagagggggctgg
gatgagggtgatgtgatgccattcttctattccaaccaaggtaaacaccacgatagtagt
agaagtagcaacattagtagtagtaataggaagttaacagaacagcgtaggacgattggg
gaggttgaccatggccctggagagggccatggcagcgttttacttagaagggcggctagg
gagaggattgcccaagcaatttattga

DBGET integrated database retrieval system