KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0479800-01Help
Entry
Os09t0479800-01   CDS       T02163                                 

Gene name
Os09g0479800
Definition
Similar to Pyrophosphate-dependent phosphofructo-1-kinase-like protein.
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dosa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dosa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dosa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dosa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dosa00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:18411615..18413012
AA seq 465 aa AA seqDB search
MDDDGETPMPSLELHKLPTLAGAAIPNPIARHPLYHPSPSFFISPTDVVLRDILFDASPA
SAAGERRRRHVAAYHRAGPRREVAFDPATVRAAIFTCGGLCPGTNTVVRELVVGLSELYG
VRGGVFGVRNGYRGFYSDEVVPLDPAAVEHWHKAGGAALGTSRGGFDLARIVDAIERHGF
NQVYAVGGDGTMRGAARIHREVRRRGRLAVAVAGIPKTVDNDVGVVDRSFGFHTAVEAAQ
QAIAAGHVEAESAANGVGLVKLMGRSAGHIALHATLSSRDVDCCLIPEEDFYLRGAGGLF
DFLYRRIKDNGHAVVVVAEGAGQRLIPRTTTTSASGACAGADESGNETFLDVGAWLKAEM
RAWWEEEHAGEVFTVKYIDPTYMIRAVPANAGDNLYCTLLAHAAIHGAMAGYTGFVSGTI
NGNYAYIPMDEVAEAKNPVDTKDHKWAWVRSITNQPDFIRAGPTS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgacggcgagacgccgatgccgtcgctcgagctccacaagctccccaccctc
gccggcgccgccatcccgaacccgatcgcgcgccacccgctgtaccacccgtcgccgagc
ttcttcatctcccccaccgacgtcgtcctccgcgacatcctcttcgacgcctcgccggcg
tcggccgccggtgagcggcggcggcggcatgtcgcggcgtaccaccgcgcgggccctcgc
cgcgaggtcgcgttcgacccagcgacggtgcgcgcggccatcttcacctgcggcgggctc
tgccccgggacgaacaccgtcgtgcgagagctcgtcgtcgggctgtccgagctctacggc
gtgcgcggcggcgtgttcggcgtgcggaacgggtaccgcggcttctactccgacgaggtc
gtcccgctcgacccggcggcggtggagcactggcacaaggccggcggggcggcgctcggc
acgtcgcgcggcgggttcgacctcgccaggatcgtggacgccatcgagcggcacgggttc
aaccaggtgtacgccgtcggcggcgacggcacgatgcgcggcgcggcgaggatccaccgc
gaggtccggcggcgggggcggctcgccgtggcggtggcggggatcccgaagacggtggac
aacgacgtcggcgtcgtcgaccggtcgttcgggttccacacggcggtggaggcggcgcag
caggcgatcgccgccgggcacgtggaggccgagagcgcggcgaacggcgtcggcctcgtc
aagctcatgggccggagcgccggccacatcgcgctccacgccacgctcagcagccgcgac
gtcgactgctgcctcatcccggaggaggacttctacctccgcggcgccggcggcctcttc
gacttcctctaccgccgcatcaaggacaacggccacgccgtcgtcgtcgtcgccgagggc
gccggccaacgtctcatcccaagaaccaccaccacctcggcctccggcgcctgcgccggc
gccgacgagtcggggaacgagacgttcctggacgtgggggcgtggctgaaggcggagatg
agggcgtggtgggaggaggagcacgccggcgaggtgttcacggtgaagtacatcgacccg
acgtacatgatccgcgccgtgccggcgaacgccggcgacaacctgtactgcacgctgctg
gcgcacgcggcgatccacggcgccatggccgggtacaccggcttcgtctccggcacgatc
aacggcaactacgcctacatccccatggacgaggtggccgaggcgaagaaccccgtggac
accaaggaccacaagtgggcttgggtcaggtccatcaccaatcagcccgactttatccgg
gccggtccgacgagctag

DBGET integrated database retrieval system