KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0505100-01Help
Entry
Os09t0505100-01   CDS       T02163                                 

Gene name
Os09g0505100
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os09t0505100-01 (Os09g0505100)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os09t0505100-01 (Os09g0505100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:complement(join(19524363..19527289,19522681..19522921))
AA seq 1055 aa AA seqDB search
MGKRVKAKAKNPRKAQQQQEPTAAAPSDAGSGDAAAAAAQDSGNSTEEAAAAAAAAASAS
GREQCGHYGGDSARLDKVLLEIMTSKHFASCEHCRDDAPRKKGGGKEKGGKQQQKKKGGG
TKGSAAKAKVEKSDMWVCLDCGRHFCGGEVDVTKPYGHARRHAKQDRHWWAARFDDPTVA
FCLSCEKEVSIEMPRIETVAAVPTEVAGAADRDLGLVNSHGSVIRGLPNLGNTCFFNAVM
QSLLALDRLRSKMLGPDVPTGALLMSLKKLFMETSASNDVGGALSPKNLFSNICSKYPQF
RGFQMQDSHELLRCFLDGLHTEENEARKLADEASSATIPTIVDSIFGGQLSSTVSSTECT
HSSVKHDQFLDLSLPVPSRRPPAKSVSSPPAKRNKQSLRDRNKNRRYGKISTRVTPTIEV
SNKEKIQTVAEGNNSLIPGSESGQVVSEKEPEPSECSESCASVPNLEQTGTSNVEDGTCW
LDYIDDADEAKSEILDSADSIEAGQIWEDKGVTYGPFLPQDDALSKEQVLGSEHSGENPI
DDATSSQPVILLPYKEFGSTANEMDGTTENSQKPEDAVAPPAVSPLPEDNAQPASVGDGD
QDDYVGLGDMFNEPEVTSEVKKEIGTVEDIDVMAWSSNSAEDEVDDSNAPVSVEGCLALF
TEPELLSEPWHCELCSDSIACPNTNDGKDDEMATSVNERKDGEEMMAGGDETQDGDKLIA
NCTEKEGIDQIMATDGCSDNLNSDMNSKEGGCANSSLVGADNSVDANFPENGKVALLKTG
SSLVDTTEQADSKAYRREIRDLNNSAVEYTSSSKQPHDSAQHKDEHNVDVASEETTAPEC
SCDNESASCSTTNKNEAECGVGAEEIVTSSLPSETQRILPGEKDNEDVVTRNHGRRKRMK
MVGKAHQGQDNQNEQKENGKKVFRSAMRRILISKAPPVLTINLNRFSQDSHGRFKKLKGH
VHFKETLDVRPFMDPRSKENDNTTYRLVGVVEHLGTMAAGHYVAYVRTGKIGGRQQRSTG
SKSWFYASDAQVREASLEEVLNCEAYILFYERVGD
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggggaagagggtgaaggcgaaggccaagaatccgaggaaagcacagcaacaacaggag
ccgacggcagcggcgccctctgatgctggatctggggatgcggcggcggcggcggcgcag
gactcggggaattcgacggaggaagctgctgctgctgctgctgctgccgcgtcggccagc
ggcagggagcagtgcggacactacggcggcgacagcgcccgcttggacaaggtcctcttg
gagatcatgacgtccaagcatttcgcgtcgtgcgagcattgccgggatgatgcccctagg
aagaaagggggtggcaaggagaaagggggtaagcagcagcagaagaagaaaggaggtgga
acgaaaggttccgcggccaaggcgaaggtggagaagagtgacatgtgggtgtgcttggac
tgcggtcggcatttctgcgggggtgaggttgatgtgaccaagccgtacggccatgcccga
aggcatgccaagcaggaccggcattggtgggctgcacggtttgatgatccgactgttgcg
ttttgtttgtcgtgtgagaaggaggtgtcgatcgagatgcctagaatagagacagttgcc
gcagtgccaacagaggtggctggtgcagctgacagagatctaggtttggttaactctcat
ggtagtgtaatcagagggctgccaaatcttgggaacacatgcttcttcaatgcagtgatg
cagagcctcctcgcgcttgataggttgcgcagtaagatgttgggaccagatgttccaacg
ggggctcttttgatgtcattgaagaaactcttcatggagacaagtgcttcaaatgatgta
ggaggtgcgctgagtccaaagaatctcttctcaaatatttgctcaaagtacccgcagttc
aggggcttccagatgcaggacagccatgaattactccgctgttttcttgatggtctgcac
acggaggaaaatgaagcacggaagctagcggatgaagcttcaagtgcaaccattcctaca
attgtcgattccatctttgggggtcagctgtctagtacagtgtccagcacagaatgcaca
cacagttctgttaaacatgaccaattccttgatctgtcactaccagttccatccaggagg
cctccagccaagagtgtgtcatcaccaccagcaaagaggaacaaacaatccctaagagat
aggaataaaaatcggagatatgggaagatttcgacccgagtgactcctacaatagaggtg
agcaacaaagaaaagattcaaacagttgctgaaggcaataattccctgattcctggttca
gagtcaggacaggttgtcagtgagaaagagcctgagccttctgaatgcagtgagtcatgt
gcttctgtgcctaatctagaacaaacaggtacttcaaatgtggaggatggcacttgctgg
ttggattacattgatgatgcagatgaagcaaaatcagagattcttgattctgcagattct
attgaagcgggacagatctgggaagacaagggtgttacttatggtccatttcttccacag
gatgatgccttatcgaaagagcaggtcttgggttctgaacactctggtgaaaaccctatt
gatgatgcaacatcttcacagcctgttatcttgcttccttacaaagaatttggttccact
gccaatgaaatggatggaaccacagaaaattcacagaaaccagaagatgcagttgctcct
ccagctgtttctcccttgccagaagataatgcacaacctgcatctgttggcgatggggat
caagatgactatgttggtcttggtgatatgttcaatgagcctgaagttacttctgaagtc
aagaaagaaataggtacagttgaagatattgatgtgatggcctggagtagcaacagtgct
gaagacgaggtggatgatagtaatgctcccgtatcagttgagggctgcttggctttgttt
actgaaccggagttgctctctgaaccatggcactgtgagctctgctctgactctattgca
tgcccaaacaccaatgatggcaaagatgatgagatggcgactagtgtcaatgaaagaaag
gatggtgaggagatgatggcaggtggtgatgaaacacaagacggtgataagttgatcgct
aactgcaccgaaaaggagggcattgatcagattatggcaactgacggttgctcagataat
ttaaatagtgatatgaacagtaaagaaggtggttgtgcaaattcttctttggttggtgct
gacaactcagttgatgctaactttccagaaaatgggaaagttgctttactgaaaacaggt
tcgtcacttgttgacacaactgaacaggcagacagcaaagcatatcgtcgagagattagg
gatttgaacaactcagcagtggaatatacatcttcgagtaagcaacctcatgattctgcc
cagcataaggatgaacataatgtggatgtagcctctgaagaaacaactgcaccagagtgt
tcttgtgacaacgaatctgcctcttgcagcacaaccaataagaatgaagctgaatgtggt
gttggtgctgaagaaattgttactagtagccttccatctgagacgcaaagaatcttacca
ggtgaaaaagacaatgaagatgttgtcacgcggaatcatggcagaaggaagcgaatgaag
atggttggcaaggcacatcaagggcaagataaccaaaatgaacagaaagagaatggaaaa
aaggttttcagatctgcaatgagaaggatccttattagcaaggcgccacctgtattgaca
attaatttgaacagattcagtcaggactcgcatggtcggttcaagaaattgaaagggcat
gtgcactttaaggagacacttgatgtgcggccattcatggacccaaggtctaaggagaat
gacaatacaacttatcgtctcgttggcgttgttgagcacttgggaaccatggcagctggg
cattatgttgcatatgtgagaactggcaagattgggggtcggcagcagaggagcaccggc
tccaagtcatggttttatgcaagtgatgcacaagtcagagaagcctctctggaggaagtt
cttaactgcgaggcttacatactgttttacgaaagggtgggagactaa

DBGET integrated database retrieval system