KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0520100-01Help
Entry
Os09t0520100-01   CDS       T02163                                 

Gene name
Os09g0520100
Definition
DNA polymerase delta, subunit 4 family protein.
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Os09t0520100-01 (Os09g0520100)
   00240 Pyrimidine metabolism
    Os09t0520100-01 (Os09g0520100)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Os09t0520100-01 (Os09g0520100)
   03410 Base excision repair
    Os09t0520100-01 (Os09g0520100)
   03420 Nucleotide excision repair
    Os09t0520100-01 (Os09g0520100)
   03430 Mismatch repair
    Os09t0520100-01 (Os09g0520100)
   03440 Homologous recombination
    Os09t0520100-01 (Os09g0520100)
DNA repair and recombination proteins [BR:dosa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      Os09t0520100-01 (Os09g0520100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:complement(join(20314233..20314407,20313928..20314148))
AA seq 131 aa AA seqDB search
MASGGMKDFYRQKKKGGPTKASSSSKKKTQHYTGGASVGASDTAQTSALISHGNLDLKDD
FSEQEEQLRLFDMDMKFGPCIGVTRLQRWERASAMGLHPPPHLRDLLLNNTHAGNHNNNG
PSLECLWEGKV
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggtggcatgaaggacttttaccggcagaagaagaaaggaggtcccaccaaa
gcatcgtcatcttccaagaagaaaacacagcattacactggaggggcctctgttggggcc
tcagacactgctcagacatcagcactaatttctcatggtaacctagatcttaaagatgat
ttcagtgagcaagaggagcagttgcgactgtttgatatggacatgaagtttggcccttgc
attggcgttactcgtcttcagcgttgggaacgtgcttctgccatgggtcttcacccacca
cctcatctcagggatctcttactgaacaatactcatgcaggcaatcacaataacaatggt
ccctcccttgagtgcctctgggagggcaaagtctag

DBGET integrated database retrieval system