KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0520100-01Help
Entry
Os09t0520100-01   CDS       T02163                                 

Gene name
Os09g0520100
Definition
DNA polymerase delta, subunit 4 family protein.
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dosa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dosa00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:dosa03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dosa03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dosa03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:dosa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dosa03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:complement(join(20314233..20314407,20313928..20314148))
AA seq 131 aa AA seqDB search
MASGGMKDFYRQKKKGGPTKASSSSKKKTQHYTGGASVGASDTAQTSALISHGNLDLKDD
FSEQEEQLRLFDMDMKFGPCIGVTRLQRWERASAMGLHPPPHLRDLLLNNTHAGNHNNNG
PSLECLWEGKV
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggtggcatgaaggacttttaccggcagaagaagaaaggaggtcccaccaaa
gcatcgtcatcttccaagaagaaaacacagcattacactggaggggcctctgttggggcc
tcagacactgctcagacatcagcactaatttctcatggtaacctagatcttaaagatgat
ttcagtgagcaagaggagcagttgcgactgtttgatatggacatgaagtttggcccttgc
attggcgttactcgtcttcagcgttgggaacgtgcttctgccatgggtcttcacccacca
cctcatctcagggatctcttactgaacaatactcatgcaggcaatcacaataacaatggt
ccctcccttgagtgcctctgggagggcaaagtctag

DBGET integrated database retrieval system