KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0530200-01Help
Entry
Os09t0530200-01   CDS       T02163                                 

Gene name
Os09g0530200
Definition
Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os09t0530200-01 (Os09g0530200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Os09t0530200-01 (Os09g0530200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:join(20764259..20764714,20764807..20765109,20766655..20766816,20766932..20767207,20767542..20767892)
AA seq 515 aa AA seqDB search
MALLSAPVRRRRSRVRVLLVCCCLLLALAAPSAAAAAAGHDYGDALAKSILFFEGQRSGR
LPAAGQRAAWRGDSAVSDGGAAGVDLEGGYYDAGDNVKFGFPMAFTATMLAWGVVEFGDA
MPPAERAHAADAVRWATDYLLKTISHPGVIFIQVGDPTKDHGCWERPEDMDTARTVYNIS
AARPGSDVAGETAAALAAASMVFRDDDPAYAARLLAGARSAFEFADEHKGAYSDDPELRA
GGCPFYCDFDGYQDELLWGAAWLRRASKEGTYLDYIQNNGKTLGAEDSTNEFGWDNKHAG
INVLVSKEFIDGEVLSLQSYKEFADGFICTLIPESSSPHITYTPGGMIYKPGGSNMQHVT
SISFLLLTYAKYLSNSSRTVNCGNVSVGPATLQQLARKQADYILGDNPMKMSYMVGYGDR
YPQRIHHRGSSLPSIKSHPQRIACNDGTPYYNSSSPNPNPLIGAVVGGPGEDDVYEDDRA
DFRKSEPTTYINAPLVGVLAYLVGNPDPGQGHVRH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcctctcggctcccgtgcgccgccgccgctcgcgcgtgcgtgtcctgctagtg
tgctgctgcttgctactggcgctcgcggcgccgtcggcggcggcggcggcggcggggcat
gactacggcgacgcgctggccaagtcgatcctgttcttcgaggggcagcggtcggggcgg
ctgccggcggcggggcagcgcgcggcgtggcgaggggactcggcggtgtcggacggcggc
gcggcgggcgtcgacctggagggcgggtactacgacgccggcgacaacgtcaagttcggc
ttcccgatggcgttcaccgccacgatgctggcgtggggcgtcgtcgagttcggcgacgcc
atgccgcccgcggagcgcgcccacgccgccgacgccgtccgctgggccaccgactacctc
ctcaagaccatctcccaccccggcgtcatcttcattcaggtgggcgacccaacgaaggac
cacgggtgctgggagcggccggaggacatggacacagcgaggacggtgtacaacatcagc
gcggcgaggccggggtcggacgtggccggggagacggcggcggcgctggccgcggcgtcg
atggtgttccgcgacgacgacccggcgtacgccgcgcggctgctcgccggcgccaggagc
gcgttcgagttcgcggacgaacacaagggcgcgtacagcgacgacccggagctcagggcc
ggcggctgcccgttctactgcgacttcgatggatatcaggatgagctgctgtggggagca
gcatggctacggagagcctccaaggaaggcacctacctcgactacattcagaacaacggc
aagacccttggagcagaggatagcaccaacgaattcggctgggacaacaagcatgccggc
atcaatgtccttgtctccaaggagttcatagatggcgaggtgctatctctgcaatcctac
aaggagtttgcagatggattcatctgcacactgattccggagtcgtcgtctccgcacatc
acgtacacgcccgggggcatgatctacaagcctggaggcagcaacatgcagcatgttaca
tccatttcgttcctgctcctgacttatgccaagtacctctccaattcctcgcgcactgtc
aactgtggaaatgtttcggttggtcctgccactcttcagcagctagccagaaagcaggct
gattatatattaggagataacccgatgaaaatgtcatacatggtcgggtacggcgatcgg
tatcctcaacggatacaccatcgaggatcatcgttgccttcgatcaagagccatccccag
cgcattgcgtgcaacgacggcacgccttactacaattcatctagcccgaacccaaacccg
ttaattggcgcagttgttggggggcctggggaggatgatgtttatgaggatgaccgtgcc
gatttcaggaaatctgaaccaactacctacatcaatgctccattggtaggagttcttgct
taccttgttggcaatcctgatccaggccaaggccatgtcaggcattga

DBGET integrated database retrieval system