KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0553200-01Help
Entry
Os09t0553200-01   CDS       T02163                                 

Gene name
Os09g0553200
Definition
Similar to UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase).
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dosa00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dosa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dosa00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dosa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr09:join(21917412..21917479,21917598..21917645,21917729..21917820,21917948..21918038,21919053..21919113,21919203..21919280,21919372..21919422,21919511..21919584,21919699..21919771,21920155..21920212,21920316..21920362,21920438..21920503,21920720..21920752,21920838..21920890,21920965..21921040,21921122..21921178,21921267..21921350,21921430..21921528,21921653..21921757,21921968..21922036,21922144..21922170)
AA seq 469 aa AA seqDB search
MAVTADVKLEGLRAATDKLDQISENEKSGFISLVSRYLSGEAEQIEWSKIQTPTDEVVVP
YDTLSAAPEDLNETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIE
SLNKKYGCNVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPLPSK
GKTGKDGWYPPGHGDVFPSLNNSGKLDTLLAQGKEYVFVANSDNLGAIVDIKILNHLIHN
QNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWV
NLKAIKRLVEAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGINVPRSRFLPV
KATSDLLLVQSDLYTLVDGFVIRNPARTNPSNPSIELGPEFKKVANFLARFKSIPSIVEL
DTLKVSGDVWFGSGVTLKGKVTITAKSGKLEIPDGAVLENKDINGPEDL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaccgccgacgtgaagctcgagggcctccgcgccgccaccgacaagctcgac
cagatcagcgagaacgagaagtccgggttcatcagcctcgtttcgcgctacctcagcggc
gaggcggagcagatcgagtggagtaagatccagaccccgaccgacgaggtggtggttccc
tacgacacgctctcggctgctcccgaagatctcaacgagacgaagaagctgctcgacaaa
ctcgtcgtgctcaagctcaatggaggcctcgggacgaccatgggctgcactggtcccaag
tctgtcattgaagtccgcaatggctttacgtttctagaccttattgtgattcaaattgag
tccctgaacaagaagtatggatgcaatgtccctttgcttctaatgaactcattcaacact
catgatgacacacagaagattgttgagaagtactccaactccaacattgaaattcacact
ttcaaccagagccaatatcctcgcattgttactgaagacttcttgccacttccaagcaag
gggaagactggcaaggatggctggtatcccccaggccatggtgatgtgttcccctccttg
aataacagtggaaaacttgataccttgttggcacagggcaaggagtatgtctttgtcgcg
aactcggacaacttgggtgctattgttgacatcaagatcttaaaccacctgatccataac
cagaacgagtactgtatggaggttactcctaaaacattggctgatgttaaaggtggtacc
ctcatctcttacgaagggagagttcagctgttggagattgctcaagtccctgatgagcat
gtgaatgaattcaagtcaattgagaagttcaagatcttcaataccaacaacctgtgggtg
aacttgaaggccatcaagaggctggtagaagctgaagcacttaagatggaaatcattcct
aaccctaaggaagttgatggtgtgaaagttctgcaactcgaaactgcagctggagcagcc
attcggttctttgaaaaagcaattggcattaatgttccccgctcgagatttctgccagtc
aaggctacatctgatttgttgcttgtacagtctgatttgtacaccttggtcgatggcttt
gtcatccgcaacccagccagaacaaacccatcaaacccttcgattgagcttggacctgag
ttcaagaaggttgccaatttcctggcccggtttaagtcaatccccagcattgtcgagctt
gacaccttgaaggtctctggtgatgtctggttcggctctggagttacactcaagggtaag
gtgaccatcaccgccaagtcagggaagttggagatcccagatggagccgtgcttgagaac
aaggacatcaacggtccggaggatctttga

DBGET integrated database retrieval system