KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0570850-00Help
Entry
Os09t0570850-00   CDS       T02163                                 

Gene name
Os09g0570850
Definition
Similar to Histone H2B.
Orthology
K11252  
histone H2B
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os09t0570850-00 (Os09g0570850)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr09:complement(join(22792917..22792931,22792228..22792671))
AA seq 152 aa AA seqDB search
MDMEMVDDNKTGAAADETPPVVPLQSQETQDPNEPKAAAAKKKKRAGHGRKRSRRRRGGA
LEYGGYKRYVWRVLKQVHPDLGASAQTMDVLDMMMADMFERLADEASRLSKLSGRLTLTS
REVQSAVRLVLPADLANHAISEGTKAISNYLS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggacatggaaatggtggacgacaacaagacgggtgcagctgcagatgagacgccgccg
gtggtgccgctgcagagccaagagacgcaggaccccaacgagcccaaggcggcggcagcg
aagaagaagaagcgcgcggggcatggaagaaaaaggagtaggaggaggagaggcggtgca
ttggagtatggcgggtacaagaggtacgtgtggcgcgtgctgaagcaggtgcaccctgac
ttgggcgcctccgcccaaaccatggacgtcctcgacatgatgatggccgacatgttcgag
cgcctcgccgacgaggcctctcgcctctccaagctctccggccgcctcaccctcacctcc
cgtgaggttcagtccgccgtccgcctcgtcctccccgccgacctcgccaaccacgccatc
tccgagggcaccaaggccatctctaactacctttcctaa

DBGET integrated database retrieval system