KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0155500-01Help
Entry
Os10t0155500-01   CDS       T02163                                 

Gene name
Os10g0155500
Definition
Similar to Aldose 1-epimerase-like protein.
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os10t0155500-01 (Os10g0155500)
   00052 Galactose metabolism
    Os10t0155500-01 (Os10g0155500)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Os10t0155500-01 (Os10g0155500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:complement(join(3477995..3478184,3477819..3477868,3476819..3476945,3476553..3476654,3475837..3476456))
AA seq 362 aa AA seqDB search
MRCLIASSSRDKTESDFSESRQVRLAVAAMAAEEILELSNGRITAKIAAWGATITSLIVP
DAHGNLADVVLGFDTLEPYMKGISPYFGCIVGRVANRIKEGKFTLNGVEYSLAINNGPNS
LHGGLKGFDKVVWDVVERKSECPSITFQYHSKDGEEGYPGDVTVRATYSLPDSTTLRLDM
EAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQIWGKHITPVDENTIPTGEIMPVKGT
PFDFTTEHKIGARINDVPGGYDHNYVLDSGEEKNGLKHAAKLKDSSNSRTLDLWTDAPGM
QFYTANYVDGVTGKGGAVYGKHSGVCLETQGFPNAINQPNFPSVVVQPGEKYKHTMLFEF
SA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcttgattgcttcatcttcacgtgataaaaccgaaagcgacttctccgagtct
cgtcaggtcagactcgcagtcgcagcaatggcggccgaggagatcttggagctctccaat
ggccgcatcaccgccaagatcgccgcctggggcgccaccatcacctccctcatcgtcccc
gacgcccacgggaatctcgcggatgtggttcttggattcgacactctggagccttacatg
aaaggcatatcaccttattttggatgcattgttggccgtgttgcaaataggatcaaggag
ggaaagtttactctgaatggagttgagtattcactagctatcaataatggacccaacagt
cttcatggtgggttgaaggggtttgacaaagtagtgtgggatgtagtagagcgcaaaagt
gaatgcccatcaatcaccttccaatatcacagcaaggatggggaagagggctaccctggc
gatgtgactgttcgagcaacatactctcttcctgattctaccaccttaagacttgacatg
gaagcagtagcagagaacaaagcgacgcccatcaacttggcgcagcacacctactggaac
ctggcagggcacaactccggtgacaccttggatcattcaatccagatctggggaaaacac
ataactccagttgacgagaacacgattcccaccggtgagataatgcctgtcaagggcaca
cctttcgacttcacaacagagcacaagattggagcccgcatcaacgatgtgcctggagga
tatgaccataactatgtgctggactctggcgaagagaagaatggcctgaagcatgctgcc
aagctgaaagattcatcgaactcacggaccctggacctctggactgatgcacctggaatg
cagttctacactgctaactatgtggatggcgtaactggcaaaggtggtgccgtttatggg
aagcattccggagtatgcttggaaacccaggggtttcctaatgccatcaaccaacccaat
ttcccctccgtggtggtgcagcctggtgagaagtataagcacactatgctgtttgagttc
tcagcctaa

DBGET integrated database retrieval system