KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0160000-01Help
Entry
Os10t0160000-01   CDS       T02163                                 

Gene name
Os10g0160000
Definition
Similar to Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15) (Ubiquitin thiolesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12).
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os10t0160000-01 (Os10g0160000)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os10t0160000-01 (Os10g0160000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:complement(join(3841098..3841246,3840288..3840512,3839592..3839736,3838707..3838766,3838514..3838609,3837549..3837941,3837329..3837469,3835851..3836021,3833832..3834089,3833594..3833739,3832724..3833281,3832334..3832607,3832049..3832228))
AA seq 931 aa AA seqDB search
MTIPSAEGFLHAASCLPCTAEEERDLVVALTREAEENVKDGDLRYLVSHSWWLNWQSYVG
LIKPDENDADMLPQAPSRPGEIDNSKLVSEESSSIGDEPELQRTLREGDDYALVPQEVWR
KLHEWYKGGPELSRRVICSSPTSRSYIVDVYPLRLKLFDGRDSLERIIRISRKAKVSELY
SLVCSLLSVEQSKIDIWDFYQKTKGKKLINLNETVEEAQLMMDQEIIIEAKADDAWCSDL
GTRSNNELALIPLEPSTSSFSIAGGPAFSNGFSSGFGSSFSQDNSFSPLLRDAEDGYSFS
NGTKDDIHGLSGLHNLGNTCFMNSAIQSLVHTPPLVEYFLQDYSREINTENPLGLQGELA
TAFGELLRKLWSAGRTSIAPRPFKTKLSRFAPQFSGYNQHDSQELLAFLLDGLHEDLNRV
KKKPYIEAKDADGRPDEELAEECWNYHKARNDSIIVDKFQGQYKSTLVCPDCKKISVTFD
PFMYLSLPLPSTVTRMINVTVFSGTGDALPMPYTVKVQKNGVCGDLIKSLSVMCCLQSCE
TLLLAEVYDHRIYRYWNPSEPLCHVKDEDKLVAYRLPVGSENLLRVEILHRVVDRYTSES
MFNLSRKLIGSPLVTCIPSDSTRKADIYATVSSLLAPFVRAKVHTLDESATKLNSNGPSL
DGIVLTDNGVTCEEDVSTSNVDEEAADEEVLPFQLWLTDDKANKREHIDADSNGVPGSTM
RLLMDWSDREHEVYDIKYMDELSVVFKPGFMSKKNRQEAVNLFSCLDAFLKDEPLGPDDM
WYCPRCTEHKQASKKLDLWRLPEILVVHLKRFSYSRFMKNKLDTFVNFPIHDLDMSRYAN
HSRGDQPPIYELYAVINHYGGMGGGHYSAYAKLVEEDSWYHFDDSHVSSVGEEDIRTSSA
YLLFYRRVGSSSCSVSKNVAVDTDMVDSLDT
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgacgataccgagcgccgaggggttcctccacgccgcgagctgcctcccgtgcacggcg
gaggaggagcgggacctcgtcgtcgcgctcaccagggaggccgaggagaatgtcaaggac
ggcgatctccgctacctcgtctcccacagctggtggcttaactggcaaagctatgtgggc
ttaatcaaacctgatgagaatgatgctgacatgcttcctcaagctccaagtagaccagga
gagatagataactcaaagctagtttcagaggaaagcagcagtattggtgatgagccagag
cttcaaagaaccctgagggaaggagatgactacgctttggtgccccaggaagtatggagg
aagctacatgaatggtacaaaggtggaccagaactctcaagaagagtaatttgtagtagt
ccaacttccagaagttacattgtggatgtctatcccctccgtctgaaattatttgatgga
agagacagcttggagagaattatcagaattagtagaaaggccaaagttagtgagctctat
agcttggtttgctcacttttgtccgtcgaacagtctaagatcgacatctgggatttttac
caaaagacaaagggaaaaaaactgataaatcttaatgagacggttgaggaagctcaactg
atgatggaccaggagattatcatagaggcaaaggcagatgatgcttggtgttcggatctt
ggtacaagatcaaataatgaactagcattaattccgttggaaccctcaacatcatcgttt
tcaattgctggaggtcctgcattttcaaatggtttttcatctggatttggttccagtttt
tcccaagataatagctttagtcctttattaagggacgcagaagatggttatagtttctcc
aatggcacaaaggatgatatccatggactgagtggtttacataacttgggaaatacatgt
ttcatgaacagtgctatacaatccttggtgcatacacctccattggtggagtacttttta
caggattacagtcgggagataaatacagaaaatccacttgggctacagggtgaacttgca
acagcatttggagaattactgagaaaactttggtcagctggtcgaacttctatagctcca
cgtccattcaagacaaaactttctcgttttgctccacagttcagtggatacaatcaacat
gattctcaggagttacttgcatttctattggatggtctgcatgaagatctcaaccgtgtg
aaaaagaaaccatatattgaagcaaaggatgccgatggccgtcctgatgaagaacttgct
gaggaatgctggaattaccataaagctcgaaatgattctataattgttgataaattccag
ggtcagtacaagtccactttggtttgcccagattgtaagaaaatctcagttacatttgac
ccattcatgtacttgtcactgccattgccctcaacagttactcgcatgattaatgtaact
gtatttagtggtactggagatgcccttcccatgccttacactgtgaaggtacaaaagaat
ggagtttgtggagatcttataaaatctctgagtgttatgtgttgcttacaaagttgcgaa
acactgttacttgcagaggtatatgatcatcggatttaccgctattggaacccatcagaa
ccactttgtcatgtaaaagatgaagacaaacttgttgcttacaggctaccggttggctct
gaaaatctcttgagggtagagatcctgcatcgggtggttgatagatatacttcagagtcc
atgtttaatcttagtcggaagctaattggaagccctcttgtgacttgtattccaagtgac
tctacaagaaaagctgatatttatgcaactgtctcttcacttctggctccatttgtgcgg
gcaaaagtacatactctggatgaatctgcaaccaagttaaatagcaatggacctagcctg
gatggtattgtactgacagacaatggtgtcacctgtgaggaagatgtatctacatcaaat
gtggatgaggaagcagctgatgaagaggttttgccatttcagctttggttgactgatgat
aaagctaataagagagagcatattgatgcagattctaacggtgttcctgggtcgaccatg
aggttattaatggactggtctgatagagaacatgaagtatatgacattaagtacatggat
gaactttctgtggtcttcaagcctggatttatgtcaaagaaaaatcggcaagaagcagtc
aatttattttcatgcttagatgcttttctgaaggatgaacctctgggccctgatgacatg
tggtactgtccgagatgcacggagcacaagcaagccagcaaaaagcttgacttatggagg
ttgcctgagatattggtagttcacttaaaaaggttctcatacagccggtttatgaagaac
aagcttgatacctttgtcaactttccaatccatgatcttgatatgagtagatatgcaaat
cactcaagaggtgatcagccccccatttatgaactctatgcagtgatcaatcattacggc
ggaatgggtggtggtcactactctgcgtatgcaaagttagtagaagaggacagttggtat
cattttgatgatagccacgtttcatctgttggcgaagaggacatcaggacatcctcagct
tatctcctgttctatcggcgagttggtagcagctcctgcagtgtgtctaaaaatgttgca
gtggacactgatatggttgattcgctggacacatag

DBGET integrated database retrieval system