KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0323900-01Help
Entry
Os10t0323900-01   CDS       T02163                                 

Gene name
Os10g0323900
Definition
Similar to Profilin A.
Orthology
K05759  
profilin
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Exosome [BR:dosa04147]
 Exosomal proteins
  Proteins found in most exosomes
   Os10t0323900-01 (Os10g0323900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:complement(join(8938091..8938213,8937850..8937987,8937582..8937716))
AA seq 131 aa AA seqDB search
MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacgtacgtcgacgagcacctgatgtgcgagatcgagggccaccacctc
acctccgccgccatcgtcggccacgacggcaccgtctgggcacagagcgccgccttccct
cagttcaaaccggaggagatgaccaacatcatgaaggacttcgacgagccggggttcctc
gccccgaccggactgtttcttggaccaaccaagtacatggtcatccaaggtgaacctggc
gctgtcattcgtggcaagaagggatcaggaggcatcacagtgaagaagaccgggcaggcg
ctggtggtcggcatctacgacgagcccatgaccccggggcagtgcaacatggtggttgag
aggctcggtgactacctcgtagagcagggcctgtag

DBGET integrated database retrieval system