KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0405600-01Help
Entry
Os10t0405600-01   CDS       T02163                                 

Gene name
Os10g0405600
Definition
Phosphofructokinase family protein.
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dosa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dosa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dosa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dosa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dosa00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr10:complement(join(13852222..13852514,13852058..13852139,13851639..13851712,13851446..13851557,13851202..13851297,13851013..13851116,13850845..13850917,13850542..13850682,13850296..13850412,13850110..13850214,13849817..13849897,13849602..13849730,13849344..13849511))
AA seq 524 aa AA seqDB search
MALKSPVDFAGSITSGQKDPCCFGVPGCNPRCVRYNKKSRTCRLVTRAISVDRPQLDFSN
SDWKKQFQEDFDRRFSLPHLKDVIDVEPRPTTFSLKSRTPLENVNGSMQGSWNGYVNDDD
RALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQYVKAGIVTCGGLCPG
LNDVIRQIVLTLEKYGVKNIVGIQHGFRGFFEDHLAEVPLNRQVVQNINLAGGSFLGVSR
GGANISDIVDSIQARRLDMLFVLGGNGTHAGANLIHEECRKRKLKVSIVGVPKTIDNDIL
LMDKTFGFDTAVEAAQRAINSAYIEAHSAFHGIGLVKLMGRSSGFITMHASLSSGQVDIC
LIPEVPFTLDGPNGVLQHLEHLIETKGFALICVAEGAGQEHLQQSNATDASGNMILGDIG
VHLHQKIKAHFKEIGVHSDVKYIDPTYMVRAVRANASDAILCTVLGQNAVHGAFAGFSGI
TTGICNTHNVYLPISEVIKSTRFVDPNSRMWHRCLTSTGQPDFH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaatcaccagtggattttgctggctcaatcacttcaggccagaaggacccg
tgttgttttggtgtgcccggctgcaatccgcgatgtgttagatacaataagaaatcaaga
acatgccgattggttactagagccatatccgtcgatcgcccgcagctagacttctcaaac
tcagactggaagaagcagttccaggaggatttcgataggcggttcagtttgcctcacttg
aaagatgtaatcgacgttgaaccgaggccaacaacgttttccctcaagagcaggacccct
ctggagaatgttaatggttctatgcaaggatcatggaatggctatgtgaatgacgatgac
agagcacttttgaaggttattaagtttgcttcaccaacatctgctggagctgattgcatt
gaccctgattgcagctgggtcgaacaatgggtgcaccgtgctggcccacgtaaacaaata
tattttgaacctcagtatgtaaaggctggaattgtcacctgtggtggactttgccctggt
ctcaatgatgtcattcggcagattgtgcttacactggaaaaatatggagtgaaaaacatt
gttggaatacagcatggtttccgtggattttttgaggatcatttagcagaagtgccactt
aataggcaagttgtccagaatatcaatcttgctggtggaagtttcttaggagtttctcgt
ggtggagcaaatatctcagacattgtcgacagcatacaggcccggaggcttgacatgctc
tttgttctaggtggaaatggaactcatgctggagctaaccttatacatgaggagtgccgc
aagagaaaactgaaagtatcaattgtgggcgttccaaaaaccattgataatgacatacta
ctgatggacaagacatttggatttgatacagcagttgaagcagcacagagagctataaac
tctgcatatattgaggcacattctgcatttcatggcattggattggtcaagctgatggga
agaagcagtggctttatcacaatgcatgcttccctgtctagtggccaagtagatatctgc
ctgatacctgaggtaccgttcactcttgatgggccaaatggagttcttcaacaccttgag
cacttgatagaaaccaagggatttgctctgatttgtgtagccgaaggagcgggacaggaa
catctgcaacagtcaaacgcaactgatgcatcagggaacatgatccttggtgatatcggc
gtgcaccttcatcagaagatcaaggcccatttcaaggaaataggagtacattctgatgtg
aagtacattgatcctacatacatggtccgtgctgtgcgtgccaatgcatccgatgccatc
ctatgcactgtgcttggtcagaatgctgttcatggtgcatttgcagggttcagtggcatc
acaaccggcatatgcaacacgcacaacgtctacttgccaatctcagaagtcatcaagtcc
acaaggttcgtcgatccaaacagcaggatgtggcaccggtgtttgacatcaacagggcaa
ccagacttccactga

DBGET integrated database retrieval system