KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0405600-01Help
Entry
Os10t0405600-01   CDS       T02163                                 

Gene name
Os10g0405600
Definition
Phosphofructokinase family protein.
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os10t0405600-01 (Os10g0405600)
   01230 Biosynthesis of amino acids
    Os10t0405600-01 (Os10g0405600)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os10t0405600-01 (Os10g0405600)
   00030 Pentose phosphate pathway
    Os10t0405600-01 (Os10g0405600)
   00051 Fructose and mannose metabolism
    Os10t0405600-01 (Os10g0405600)
   00052 Galactose metabolism
    Os10t0405600-01 (Os10g0405600)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Os10t0405600-01 (Os10g0405600)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Os10t0405600-01 (Os10g0405600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr10:complement(join(13852222..13852514,13852058..13852139,13851639..13851712,13851446..13851557,13851202..13851297,13851013..13851116,13850845..13850917,13850542..13850682,13850296..13850412,13850110..13850214,13849817..13849897,13849602..13849730,13849344..13849511))
AA seq 524 aa AA seqDB search
MALKSPVDFAGSITSGQKDPCCFGVPGCNPRCVRYNKKSRTCRLVTRAISVDRPQLDFSN
SDWKKQFQEDFDRRFSLPHLKDVIDVEPRPTTFSLKSRTPLENVNGSMQGSWNGYVNDDD
RALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQYVKAGIVTCGGLCPG
LNDVIRQIVLTLEKYGVKNIVGIQHGFRGFFEDHLAEVPLNRQVVQNINLAGGSFLGVSR
GGANISDIVDSIQARRLDMLFVLGGNGTHAGANLIHEECRKRKLKVSIVGVPKTIDNDIL
LMDKTFGFDTAVEAAQRAINSAYIEAHSAFHGIGLVKLMGRSSGFITMHASLSSGQVDIC
LIPEVPFTLDGPNGVLQHLEHLIETKGFALICVAEGAGQEHLQQSNATDASGNMILGDIG
VHLHQKIKAHFKEIGVHSDVKYIDPTYMVRAVRANASDAILCTVLGQNAVHGAFAGFSGI
TTGICNTHNVYLPISEVIKSTRFVDPNSRMWHRCLTSTGQPDFH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaatcaccagtggattttgctggctcaatcacttcaggccagaaggacccg
tgttgttttggtgtgcccggctgcaatccgcgatgtgttagatacaataagaaatcaaga
acatgccgattggttactagagccatatccgtcgatcgcccgcagctagacttctcaaac
tcagactggaagaagcagttccaggaggatttcgataggcggttcagtttgcctcacttg
aaagatgtaatcgacgttgaaccgaggccaacaacgttttccctcaagagcaggacccct
ctggagaatgttaatggttctatgcaaggatcatggaatggctatgtgaatgacgatgac
agagcacttttgaaggttattaagtttgcttcaccaacatctgctggagctgattgcatt
gaccctgattgcagctgggtcgaacaatgggtgcaccgtgctggcccacgtaaacaaata
tattttgaacctcagtatgtaaaggctggaattgtcacctgtggtggactttgccctggt
ctcaatgatgtcattcggcagattgtgcttacactggaaaaatatggagtgaaaaacatt
gttggaatacagcatggtttccgtggattttttgaggatcatttagcagaagtgccactt
aataggcaagttgtccagaatatcaatcttgctggtggaagtttcttaggagtttctcgt
ggtggagcaaatatctcagacattgtcgacagcatacaggcccggaggcttgacatgctc
tttgttctaggtggaaatggaactcatgctggagctaaccttatacatgaggagtgccgc
aagagaaaactgaaagtatcaattgtgggcgttccaaaaaccattgataatgacatacta
ctgatggacaagacatttggatttgatacagcagttgaagcagcacagagagctataaac
tctgcatatattgaggcacattctgcatttcatggcattggattggtcaagctgatggga
agaagcagtggctttatcacaatgcatgcttccctgtctagtggccaagtagatatctgc
ctgatacctgaggtaccgttcactcttgatgggccaaatggagttcttcaacaccttgag
cacttgatagaaaccaagggatttgctctgatttgtgtagccgaaggagcgggacaggaa
catctgcaacagtcaaacgcaactgatgcatcagggaacatgatccttggtgatatcggc
gtgcaccttcatcagaagatcaaggcccatttcaaggaaataggagtacattctgatgtg
aagtacattgatcctacatacatggtccgtgctgtgcgtgccaatgcatccgatgccatc
ctatgcactgtgcttggtcagaatgctgttcatggtgcatttgcagggttcagtggcatc
acaaccggcatatgcaacacgcacaacgtctacttgccaatctcagaagtcatcaagtcc
acaaggttcgtcgatccaaacagcaggatgtggcaccggtgtttgacatcaacagggcaa
ccagacttccactga

DBGET integrated database retrieval system