KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0407000-01Help
Entry
Os10t0407000-01   CDS       T02163                                 

Gene name
Os10g0407000
Definition
Pectin lyase fold/virulence factor domain containing protein.
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os10t0407000-01 (Os10g0407000)
   00500 Starch and sucrose metabolism
    Os10t0407000-01 (Os10g0407000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Os10t0407000-01 (Os10g0407000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:complement(join(13934919..13935221,13934195..13934299,13934004..13934081,13933729..13933916,13933385..13933558,13933100..13933262))
AA seq 336 aa AA seqDB search
MAQQQPRRVLRVAPPGRGGARAEAERGEEGEAVFATVQAAVDAVPVGNRVRTVIRLAPGT
YREPVYVAKAKNLVTLSGEAGSPEATVITWDNTATRIKHSQSSRVIGTGTFGCGTIIVEG
EDFIAENITFENSAPQGSGQAVALRVTADRCAFYNCRFLGWQDTLYLHYGKQYLRDCYIE
GNCDFIFGNSIALLEHCHIHCKSAGYITAHSRKSSSETTGYVFLRCIITGNGEAGYMFLG
RPWGPFGRVVFAHTFMDRCIKPAGWHNWDRSENERTACFFEYRCSGPGFRPSNRVAWCRQ
LLDVEVENFLSHSFIDPDLDRPWLIQMMAIKVPVSA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcagcagccgcggcgagttctccgcgtggcgccgccggggcgaggaggggcg
cgcgcggaggcggagcggggggaggagggggaggcggtgttcgcgacggtgcaggcggcg
gtggacgcggtgccggtggggaacagggtgcggacggtgatccgcctcgcgccggggacg
tacagggagcccgtctacgtcgccaaggccaagaacctcgtcaccctctccggcgaggcc
ggctcgcccgaggccaccgtcatcacctgggacaacaccgccacccgcatcaagcactcc
cagtcgtccagggttattgggacaggaacgtttggatgcggaacaattattgtggagggg
gaggatttcatcgcagagaatatcacatttgagaactcagctcctcaggggtctgggcag
gcagttgctctccgagtaacagcagataggtgtgccttctacaattgcaggttccttggt
tggcaagacacattatatttacattatggaaaacaatacttaagggactgttacatcgaa
ggtaactgtgacttcatcttcggcaactctattgccctgttggaacattgccatattcat
tgcaaatcagcgggttacattactgctcacagccggaaatcctcatcagaaactactggt
tatgtgttcttgaggtgtattattactggaaatggagaagctggatatatgttcctgggt
cggccttggggaccgtttggaagggttgtctttgcgcacacttttatggatcgttgtatt
aagcctgctgggtggcataattgggacagatctgagaatgaacgaactgcttgcttcttt
gagtacaggtgctcagggccaggtttccgcccatcaaaccgagtggcttggtgtagacaa
ttgcttgatgttgaagtggagaatttcctttctcactctttcattgatccagaccttgat
aggccttggctcatccagatgatggcaataaaagtaccagtctcagcatag

DBGET integrated database retrieval system