KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0415900-01Help
Entry
Os10t0415900-01   CDS       T02163                                 

Gene name
Os10g0415900
Definition
Similar to General control of amino-acid synthesis 5-like 2 (Fragment).
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Os10t0415900-01 (Os10g0415900)
Transcription machinery [BR:dosa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Os10t0415900-01 (Os10g0415900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:complement(join(14554968..14555432,14554758..14554822,14554611..14554691,14554434..14554505,14553877..14554045,14553384..14553427,14553112..14553211,14552854..14552922,14552212..14552266,14551233..14551348,14550418..14550511,14550166..14550307,14549399..14549462))
AA seq 511 aa AA seqDB search
MDGLAAPSPSHSGATSGGGASHRKRKLPPSSLSDATADEDDDTTAPSSPSTSPSSPSRPS
SPSSSHSDDDDDDSLHTFTAARLDGAPPSSSGRPPKPESSTVSAAAAAAAAAAAPKPDSA
SAAAGDGKEDPKGLFTDNIQTSGAYSAREEGLKREEEAGRLKFLCYSNDGVDEHMIWLVG
LKNIFARQLPNMPKEYIVRLVMDRTHKSMMVIRNNIVVGGITYRPYTSQKFGEIAFCAIT
ADEQVKGYGTRLMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITLDKERWQGY
IKDYDGGILMECRIDQKLPYVDLATMIRRQRQAIDEKIRELSNCHIVYSGIDFQKKEAGI
PRRTMKPEDIQGLREAGWTPDQWGHSKSRSAFSPDYSTYRQQLTNLMRSLLKNMNEHPDA
WPFKEPVDSRDVPDYYDIIKDPIDLKTMSKRVESEQYYVTLEMFVADMKRMFSNAKTYNS
PDTIYYKCASRLESFFSNKVASQLAQASTKN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggacgggctcgcggcgccctcgccgtcccactccggcgcgacgtccggcggcggcgcc
tcccaccgcaagcggaagctcccgccgtcgtccctctccgacgccaccgccgacgaggac
gacgacaccaccgcgccgtcgtcgccgtccacctccccgtcgtcgccctcacgcccgtcc
tccccgtcctcctcccactccgacgatgacgacgacgactccctccacaccttcaccgcc
gcccgcctcgacggcgcgcccccgtcctcatccggccgcccgccgaagcccgagtcctcg
accgtgtctgccgccgccgcggccgcggctgcagcggccgctcccaagcccgattccgct
tccgctgccgccggcgacggcaaggaggacccgaaggggttgttcactgacaacattcag
accagtggcgcgtatagcgctcgagaggagggcctcaagcgtgaggaagaagcagggagg
ctgaaatttctatgctattctaatgatggagttgatgaacatatgatttggttggtaggc
ttgaagaatatctttgctcggcagcttcctaacatgcccaaagagtacattgtccgtctt
gttatggatagaactcacaaatcaatgatggttatcaggaataatattgttgtaggaggc
attacttaccggccttatacaagccagaagtttggagaaatagcattttgtgcaattaca
gctgatgagcaagttaaaggctatgggacacggttaatgaatcacctgaagcaacatgcc
cgagatgctgatgggctcactcatttcttaacttatgcagataacaatgccgttggctat
tttgtaaagcagggtttcacaaaggagatcacattggacaaagaaagatggcaagggtac
attaaagactatgatggaggaatattgatggagtgcagaattgatcaaaagttgccatat
gttgatctggcaacgatgattaggcgtcaaagacaggcaattgatgagaaaatcagagag
ctttcaaactgccatattgtttattctggaattgacttccaaaagaaagaagctggtatt
ccaagaagaacgatgaaaccagaagacatccaaggcttgagggaagctgggtggacgcca
gatcagtgggggcattccaaatcaagatcagccttttctcctgattacagtacttacagg
caacaacttactaatctaatgcgttcattgttgaagaatatgaatgagcatcctgatgct
tggccattcaaagagccagtggattcacgtgatgttcctgactattatgacattatcaaa
gatcctattgatttgaagacaatgtcaaaaagagttgagtctgagcagtattatgtgacg
ctagagatgtttgtagctgacatgaagagaatgttcagcaatgcaaaaacttataactct
cccgatacaatctattacaagtgtgcctcacggctcgagagcttcttctcaaacaaagta
gcatctcagcttgcccaagcctcaacgaagaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system