KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0419400-01Help
Entry
Os10t0419400-01   CDS       T02163                                 

Gene name
Os10g0419400
Definition
Similar to SIPL.
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Os10t0419400-01 (Os10g0419400)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Os10t0419400-01 (Os10g0419400)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Os10t0419400-01 (Os10g0419400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:complement(join(14754216..14754233,14753454..14753565,14753248..14753342,14753014..14753128,14752779..14752903,14752365..14752435,14752200..14752263))
AA seq 199 aa AA seqDB search
MENEFQDGKTEVIEAWYMDDSEEDQRLPHHREPKEFIHVDKLTELGVISWRLNPDNWENC
ENLKRIREARGYSYVDICDVCPEKLPNYETKIKSFFEEHLHTDEEIRYCLEGSGYFDVRD
QNDQWIRIALKKGGMIVLPAGMYHRFTLDTDNYIKAMRLFVGDPVWTPYNRPHDHLPARK
EFLAKLLKSEGENQAVEGF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgaattccaggatggtaagacggaggtgatagaagcatggtacatggatgat
agcgaagaggaccagaggcttcctcatcaccgcgaacccaaagaattcattcatgttgat
aagcttacagaactaggagtaatcagctggcgcctaaatcctgataactgggagaattgc
gagaacctgaagagaatccgcgaagccagaggttactcttatgtggacatttgtgatgtg
tgcccagagaagctgccaaattatgaaactaagatcaagagtttctttgaagaacacctg
cataccgatgaagaaatacgctattgtcttgaagggagtggatactttgatgtgagagac
caaaatgatcagtggattcgtatagcactgaagaaaggaggcatgattgttctgcctgca
gggatgtaccaccgctttacgttggacaccgacaactatatcaaggcaatgcgactgttt
gttggcgatcctgtttggacaccctacaaccgtccccatgaccatcttcctgcaagaaag
gagtttttggctaaacttctcaagtcagaaggtgaaaatcaagcagttgaaggcttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system