KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0467600-01Help
Entry
Os10t0467600-01   CDS       T02163                                 

Gene name
Os10g0467600
Definition
Similar to cap-binding protein p28.
Orthology
K03259  
translation initiation factor 4E
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os10t0467600-01 (Os10g0467600)
Translation factors [BR:dosa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Os10t0467600-01 (Os10g0467600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr10:join(17258323..17258531,17259501..17259669,17259799..17259924,17260778..17260843,17260962..17261012)
AA seq 206 aa AA seqDB search
MAEVEAAPIAAAETPEVAAAEGAAAAKAPHKLHRQWAFWYDIQSKPKPGAAWGTSLRKAY
TFDTVEEFWGLYDQIFRPSKVTVNADFHLFKAGVEPKWEDPECANGGKWTVPCSRKTTLE
NMWLETLMALIGEQFDESEEICGVVASVRQRGDKLALWTRTASNEAVQVNIGKKWKEIVD
YNDKMVYSFHDDAKREKPSRGGRYNV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggtggaggcagcgccgattgcggcggcggagaccccggaggtggcggcggcg
gagggagcggcggcggcgaaggcgccgcacaagctgcataggcagtgggcgttctggtac
gacatccagtccaagcccaagcccggcgccgcgtgggggacctcgctccgcaaggcctac
accttcgacaccgtcgaggagttctggggcttgtatgatcagattttccgtccaagcaag
gtgacagtaaatgctgattttcatttattcaaggctggtgtagaaccaaagtgggaagac
ccagagtgtgcaaatgggggcaaatggactgtgccatgtagcaggaagaccacccttgag
aacatgtggcttgaaacgctgatggctctgattggagagcagtttgatgaaagtgaggaa
atttgtggagttgttgctagtgtccgccagagaggagacaagcttgcattgtggactagg
actgccagcaatgaagccgttcaggtaaacattggcaagaaatggaaggagattgttgac
tacaatgataagatggtctacagcttccatgatgacgccaagagggagaaaccaagcaga
ggtggacggtacaacgtgtaa

DBGET integrated database retrieval system