KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0473400-01Help
Entry
Os10t0473400-01   CDS       T02163                                 

Gene name
Os10g0473400
Definition
Beta-glucosidase, GBA2 type domain containing protein.
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dosa00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dosa00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:complement(join(17592219..17592299,17592023..17592133,17591840..17591896,17591633..17591709,17591426..17591525,17590682..17590755,17589977..17590077,17589644..17589747,17588968..17589021,17588630..17588685,17588508..17588546,17588276..17588417,17587988..17588172,17587364..17587431,17587074..17587146,17586873..17586934,17585435..17586716,17584939..17585197))
AA seq 974 aa AA seqDB search
MVSGNLFHCRRNSWPAEEYVGRTALQLLDFDGGSPPEQAWRRRLNSHANLLKEFSVTFME
AMRMMSLGLRLWSYVREEASHGRKAPIDPFTKEKCKPSASQGVPLGGMGSGSISRGFRGE
FKNWHIIPGLCETSPVMENQFSIFVSRDGGNKKYSSVLSPGHHEGLKKCNDSGISSWDWN
LSGQHSTYHALFPRAWTVYDGEPDPDLKISCRQISPFIPHDYKDSSLPTSVFVYTLVNTG
KDRAKVSLLMTWANSIGGFSHHSGGHFNEPFIAEDGVSGVLLHHKTAKDNPPVTFAIAAC
ETQNVNVTVLPVFGLSGEGHDSAKQMWDRMKQNGHFDRENFEAGTSMPSSSGETLCAAVS
ASTWVEPHGRCTVVFGLAWSSPKIKFQKGCTYNRRYTEFYGTSERSAVNLVHDALTKYRI
WEEEIEKWQNPILKNEKLPEWYKFTLFNELYFLVAGGTVWTDGQPPVIDEKPSPGSNQQK
SSKRGTRDTKQESVKDNHVKLTAEQVTNGGDLANGEEQSVSKYAAVHGPQMAKATNGLGS
QEPIPYLLSKNGPENVGKFLYLEGVEYIMWCTYDVHFYASFALLDLFPKIELSIQRDFAN
AVLYEDRRRMKFLADGTSGIRKVKGAVPHDLGTHDPWHEMNAYNIHDTSKWKDLNPKFVL
QVYRDFAATGDMSFGRDVWPAVCAVMDYMNQFDRDGDGLIENDGFPDQTYDAWTVHGISA
YCGGLWLAALQAAATMAHRLGDRPFAEKYKLKFIQAKAVYEAKLWNGSYFNYDSGTSSNS
RSIQADQLAGQWYAASSGLPPLFDENKIRSALQKIFEFNVMKVKGGRLGAVNGMTPNGKV
DETCMQSREIWTGVTYGVAANMLLHGMEHQGFTTAEGIFIAGWSEEGYGYWFQTPEGWTI
DGHYRSLIYMRPLAIWAMQWARSPPKAILDAPKVNLMDRIHLSPQMIRAMNEINVRKIAP
DNRCFPSSAFRCEC
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcggcaacctcttccactgccggaggaactcgtggccggccgaggagtacgtc
ggccgaaccgccctgcagttgttggacttcgacggcgggtcgcctccggagcaggcatgg
cggcggcgtctgaacagccacgccaacttactcaaggaattcagcgtcaccttcatggaa
gcaatgaggatgatgagccttggcctgaggctatggtcgtatgtccgagaggaggcttct
catggaaggaaagctccaattgatccgtttaccaaagagaaatgtaagccgtctgcttcg
cagggcgtaccgcttggtgggatggggagtggtagcatttcaagaggtttcaggggagag
ttcaagaattggcatatcattcctggtttatgtgagacttccccggtcatggagaaccag
ttttcaatatttgtatctcgcgatggggggaacaaaaagtactcatcggtattgtctccc
ggacaccatgaaggtttaaagaaatgtaatgactctggaatttcttcatgggactggaac
ttgagcggtcaacattctacctatcatgctttatttcctagggcatggactgtttatgat
ggtgaaccggatccagaccttaaaatctcatgtcgtcagatatcaccattcattcctcat
gattacaaagatagcagcctcccaacttctgtctttgtgtacactctagtgaacactggg
aaagaccgtgcgaaagtgagcctgttaatgacatgggcgaattctatcggaggtttttct
catcactctggaggccattttaatgagcccttcattgcggaggatggagtttcaggagtt
cttctgcatcacaaaacagcaaaggataatcctccggttacttttgctattgctgcctgt
gaaactcagaatgtgaatgtgacagtcttgcctgtatttggcctctctggagaaggccat
gattcagccaagcaaatgtgggatagaatgaaacagaacggccactttgaccgtgaaaat
ttcgaagctggtaccagtatgccttcatcttcaggggagacactttgtgcagctgtctca
gcatcaacctgggtagagccacatggtagatgtactgttgtatttggtttggcttggtcc
tctcctaaaataaagtttcagaagggctgcacatacaacaggaggtacactgaattttat
ggaacttctgaaagatcagctgttaatttggtacacgatgccttgacaaaatataggatt
tgggaagaggagattgagaagtggcaaaaccccatactcaagaatgaaaaacttccagaa
tggtacaagttcacactttttaatgagctttactttctggtagctgggggtactgtttgg
acagatggccaaccaccagttatcgatgaaaaaccaagtcctggttctaatcaacagaaa
tcttcaaaaaggggcactagagacactaaacaggaatcagttaaagataaccatgtcaaa
ctgacagcagagcaagtcactaatggtggtgacctggctaatggcgaagagcaaagtgtg
tcaaagtatgcagcagtacatggaccacaaatggctaaggcaaccaacggacttgggtca
caagagccaattccatacttgctttccaagaatggccctgaaaatgttggcaaatttttg
tacctggaaggagtggaatacatcatgtggtgcacctatgatgtgcatttctatgcttct
tttgctctgcttgatctgtttcccaaaatagagttgagtatccaacgtgattttgccaat
gctgttctctatgaagacagacgaagaatgaaatttttggctgatggtacttctggaatt
cgcaaggtcaaaggtgccgttccgcatgacctaggaacacatgatccatggcatgaaatg
aatgcgtacaacatacatgatacaagcaaatggaaagatctaaatccaaagtttgtgctc
caggtatacagagacttcgctgctacaggtgatatgtcatttggtagagatgtttggcct
gccgtctgtgcagtgatggactatatgaatcaatttgaccgtgacggtgatggtctcatt
gagaatgatgggtttcctgatcaaacctatgatgcttggactgtacacggaattagtgct
tactgtggcggtctctggcttgctgcacttcaggctgcagctacaatggctcatcggctt
ggtgatcggccatttgctgaaaaatacaagctcaaattcatacaagcgaaagcagtatat
gaggctaagttatggaatgggtcttacttcaattatgacagtggcacaagcagtaatagc
cgatctattcaggcggatcagctggcagggcagtggtatgctgcttcttcaggcttgccc
ccgcttttcgatgagaataaaataagaagtgctctgcagaaaatatttgaattcaatgta
atgaaggttaaaggaggacgattgggagctgtaaatggtatgactcctaatgggaaagtg
gatgagacatgcatgcaatctcgggaaatctggaccggtgttacatacggtgttgctgca
aacatgctgctccatggaatggagcatcaaggattcaccactgccgaaggaatttttatt
gctggttggtcagaagaaggatatgggtattggttccaaacaccggaaggctggaccata
gacgggcactacaggtcgctcatctacatgcggcctctcgccatttgggcaatgcaatgg
gcacgttctccacccaaggcaatccttgatgcccccaaggtaaacctgatggacaggata
cacctatccccacaaatgatccgggcaatgaacgagattaatgttagaaagatagcaccc
gacaatagatgtttccctagctctgcatttcgttgtgaatgctga

DBGET integrated database retrieval system