KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0493600-01Help
Entry
Os10t0493600-01   CDS       T02163                                 

Gene name
Os10g0493600
Definition
Alpha-galactosidase precursor (EC 3.2.1.22) (Melibiase) (Alpha-D- galactoside galactohydrolase).
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dosa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dosa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dosa00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dosa00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Structure
PDB: 

Jmol
Position
chr10:join(18733344..18733543,18735569..18735627,18738208..18738264,18738426..18738460,18738798..18738901,18739051..18739126,18739226..18739284,18739364..18739429,18739519..18739602,18739684..18739748,18739839..18739921,18740013..18740101,18740186..18740237,18740347..18740487,18740576..18740659)
AA seq 417 aa AA seqDB search
MARASSSSSPPSPRLLLLLLVAVAATLLPEAAALGNFTAESRGARWRSRRARRRAFENGL
GRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNF
VPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVD
YLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGD
IADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLL
IGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWN
RQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcctcgagctcctcgtctccgccgtcgccgcgcctcctcctcctcctcctg
gtggcggtggcggcgacgctgctccccgaggcggcggcgctgggcaacttcacggcggag
tcccgcggcgcgcggtggcggtctcgccgcgcgcggcgccgcgccttcgagaacggcctc
ggccgcacgccgcagatggggtggaatagctggaaccacttctactgcgggatcaacgag
cagatcatcagggaaacagctgatgcattggtcaacactggtctggcgaaattggggtac
cagtatgtgaatatagatgattgctgggcagaatatagtagggattcccagggtaacttt
gtgccaaataggcagacgttcccctctggtatcaaggcactggcagattatgtgcatgca
aaagggctgaagcttggcatctacagcgatgccgggtcacaaacatgcagtaacaaaatg
ccaggatcacttgatcatgaagagcaagatgtcaagaccttcgcgtcttggggagttgat
tatctgaagtatgacaactgcaatgatgctggcaggagtgtcatggaaagatacactaga
atgagcaatgccatgaagacctatggaaagaatatcttcttctcactctgtgaatggggg
aaagaaaatcctgctacatgggcaggccgcatgggtaacagctggagaacaactggcgac
atcgccgacaactggggcagtatgacatctcgtgcagacgaaaatgaccaatgggctgcc
tatgctggacctggtggatggaatgatcctgacatgcttgaagtgggaaatggtgggatg
tctgaagctgagtaccggtcacacttcagtatctgggcactagcaaaggctcctcttttg
atcggatgcgatgtgcgctcaatgagccagcagacgaagaacatactcagcaactcggag
gtgatcgctgtcaaccaagatagtctaggtgtccaaggaaagaaagtacaatctgacaac
ggattggaggtttgggccgggccactcagcaacaacaggaaggctgtggtgctctggaac
aggcagtcataccaggcaaccatcactgcacattggtcgaacatcgggctcgctggatcg
gtcgcggtcactgctcgtgatctatgggcgcactcttcgttcgcggctcagggacagata
tcagcatcggtggcgcctcatgactgcaagatgtatgtcttgacaccaaactag

DBGET integrated database retrieval system