KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0533600-01Help
Entry
Os10t0533600-01   CDS       T02163                                 

Gene name
Os10g0533600, MPK6, MITOGEN-ACTIVATED_PROTEIN_KINASE_6
Definition
Similar to Mitogen-activated protein kinase homolog MMK2 (EC 2.7.1.37).
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Os10t0533600-01 (Os10g0533600)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Os10t0533600-01 (Os10g0533600)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os10t0533600-01 (Os10g0533600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:join(20756356..20756528,20756798..20756927,20757952..20758089,20758271..20758603,20758821..20759004,20759078..20759250)
AA seq 376 aa AA seqDB search
MDSSSGGAGGGGGAQIKGMGTHGGRYVLYNVYGNFFEVSSKYAPPIRPIGRGAYGIVCAA
VNSENGEEVAIKKIGNAFDNHIDAKRTLREIKLLRHMDHENIIAIKDIIRPPRRDNFNDV
YIVSELMDTDLHQIIRSNQPLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLFLNAN
CDLKIADFGLARTTTETDLMTEYVVTRWYRAPELLLNCSQYTAAIDVWSVGCILGEIVTR
QPLFPGRDYIQQLKLITELIGSPDDSSLGFLRSDNARRYMKQLPQYPRQDFRLRFRNMSA
GAVDLLEKMLVFDPSRRITVDEALHHPYLASLHDINEEPTCPAPFSFDFEQPSFTEEHIK
ELIWRESLAFNPDPPY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggattcctcctccggcggcgcgggcggcggcggcggcgcgcagatcaaggggatgggg
acgcacgggggccgctacgtgctgtacaacgtgtacgggaacttcttcgaggtctcctcc
aagtacgcccctcccatccgccccatcggccggggcgcctacggcattgtctgcgcggct
gttaactcggagaacggcgaggaagttgccatcaagaagattggcaatgcattcgacaac
catatcgatgccaagcggacactgagagaaatcaagctgcttcgccacatggaccacgag
aatattattgccataaaggacataattcgccccccaagaagagacaactttaatgatgtt
tacattgtttctgagttgatggatactgatctccatcagatcatacgctcaaatcaacca
ttgactgatgaccactgccagtacttcctgtaccagttgctacgagggctaaaatatgtg
cactcggcaaatgtcttgcaccgtgatctgaagccaagcaatttgttccttaatgcaaat
tgtgatctcaagattgctgattttgggcttgcaagaaccactacggagactgacctcatg
acagagtatgtggtcactcgttggtatcgagcaccagagctgctgttgaactgctcgcag
tatactgctgctattgatgtctggtcagttggatgcatacttggtgaaattgtgactcgt
caacccctgtttcctggaagggattacattcagcaactaaaattgatcactgagctgata
gggtcgccagatgactcaagcctagggtttcttcggagtgataatgcaagaagatacatg
aaacagctaccacagtacccaaggcaggacttccgcttgcgcttccgcaacatgtctgct
ggtgcagtcgatctgttagagaaaatgctggtgtttgacccaagcagacggataactgtt
gatgaggctcttcatcacccatacttggcttctcttcatgacatcaatgaagaacccacc
tgcccagcacctttcagctttgattttgagcaaccatcctttactgaagaacatataaaa
gaactcatctggagggaatccttggcatttaatccggatcctccctactaa

DBGET integrated database retrieval system