KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0552900-01Help
Entry
Os10t0552900-01   CDS       T02163                                 

Gene name
Os10g0552900
Definition
Crotonase, core domain containing protein.
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os10t0552900-01 (Os10g0552900)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Os10t0552900-01 (Os10g0552900)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Os10t0552900-01 (Os10g0552900)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Os10t0552900-01 (Os10g0552900)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Os10t0552900-01 (Os10g0552900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr10:complement(join(21704613..21704753,21704438..21704518,21704034..21704102,21703897..21703960,21703467..21703546,21703300..21703383,21703055..21703139,21702848..21702933,21702622..21702743,21701999..21702059,21701589..21701687,21701402..21701503,21701199..21701240,21700973..21701092))
AA seq 411 aa AA seqDB search
MPTLAAAAAAARRAGGALRYAVLGGVRSLSSLQPSSSSSAAAAASEEVLVEGKASARAAV
LNRPGHLNALTTTMGARLNKFYMSWEDNPDIGFVMMKGSGRAFCAGGDVVRLHQLISEGK
LDECKDFFKTLYSFIYVLGTYLKPHVAILDGVTMGGGGGVSIPGTFRIVTDRTVFATPEV
HIGFHPDAAASFYLSHLTGHVGEYLALTGEKLNGVDMIALGLATHYSMSDRLNLVDERLA
TLLTDDPSVIDTSLTHYGDLVYPDKSSIVHRLEVIDKCFSLETVEEIVDAMEIEAARLNE
DWSTLALKRLKEASPLALKVSLRSIREGRYQTLDECLVREYRMSINGISEKFSHEFREGV
RARLVEKDLAPKWDPPALEYVSADMVDSYFAPLGEFEPELTLPTESREAFV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccctcgccgccgccgccgccgccgcccgccgcgccggcggggcactgcgatac
gccgtgctgggcggggttcggtcgctctcatccctccagccgtcatcctcctcctccgcc
gcagccgccgccagcgaggaggtgctggtggaaggcaaggccagcgcgcgcgccgccgtg
ctcaaccgccccggccatctcaacgcgctcacgaccaccatgggagctaggctcaataag
ttttatatgtcatgggaggacaaccctgatattggctttgtcatgatgaagggcagcggc
cgagcattctgtgctggtggggatgttgttaggttgcaccagcttataagtgaaggaaag
ttggacgagtgtaaggatttcttcaagactttgtacagttttatttatgttctgggcaca
tacttgaagccacatgttgccattcttgatggtgttaccatgggtggaggtggaggtgtt
tccattcccggaacatttcgcattgtcactgatagaacggtatttgcaactccagaagta
catattggcttccatcctgatgctgctgcctccttttatttgtcccatctgactggtcat
gttggtgaatatttggccttgactggtgaaaaactcaatggagtggatatgatcgcactt
ggccttgctacacactattccatgagtgatcggttgaatctggttgatgaacgccttgca
acattgttaactgatgatccatcagttattgatacttcccttacacattatggagatctt
gtgtatccagataagagtagcattgttcataggctggaggttatagataaatgtttcagc
cttgaaacagtcgaggagattgtggatgccatggaaattgaagcagctaggttaaatgaa
gattggtctaccttggccctgaaacggttgaaagaggcttctcctcttgcgttgaaagtt
tcactgcgatcgatacgtgaaggtagataccagacacttgatgaatgccttgtgcgtgaa
taccgcatgtctatcaatggaatctcagagaaattttctcatgaatttcgtgagggtgtc
agagcacgtcttgtggagaaggacctagctccaaagtgggatccacctgcccttgagtat
gtatcagcggacatggtcgattcttactttgctcccctgggtgaatttgagcctgagttg
acactgcctactgaatcgcgagaggcatttgtatga

DBGET integrated database retrieval system